KEGG   Bacillus subtilis subsp. subtilis 168: BSU13120
Entry
BSU13120          CDS       T00010                                 

Symbol
proB
Name
(RefSeq) glutamate 5-kinase 1
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00330  Arginine and proline metabolism
bsu00332  Carbapenem biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01230  Biosynthesis of amino acids
Module
bsu_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    BSU13120 (proB)
  09110 Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    BSU13120 (proB)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     BSU13120 (proB)
SSDB
Motif
Pfam: AA_kinase PUA
Other DBs
NCBI-GeneID: 936790
NCBI-ProteinID: NP_389195
Pasteur: BG10963
BSORF: BG10963
UniProt: P39820 A0A6M4JHC5
Position
1378496..1379593
AA seq 365 aa
MKKQRIVVKIGSSSLTNSKGSIDEAKIREHVQAISVLKKAGHEMILITSGAVAAGFSSLG
YPSRPVTIKGKQAAAAVGQTLLMQQYMNQFKQYSLTPGQILLTRNDFSKRERYRNAYATI
MELLERGVIPIINENDSTSVEELTFGDNDMLSALVSGLIHADQLMILTDINGLYDANPNE
NPEAKRFDYLPEITPELLGYAGSAGSKVGTGGMKSKLLATQTALSLGVKVFIGTGSGEQK
LADILDGRGDGTYIGDKELSSVNNTRQWIQFHSPISGEIIIDAGAEEAMIHNGSSLLPAG
VVGVNGSFPKGAVVEVRGPGGVIGKGQTHYSSEEIMEAKGKRSDELDFEKTFEVIHRNDW
VNVKD
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgaaaaaacaaagaatagtagtgaaaataggaagcagttcgctcacgaatagcaaagga
agcattgatgaggcaaaaatcagagagcatgttcaggcgatttccgtgttaaaaaaagcg
gggcatgaaatgattctgattacctcgggtgccgtagcggcggggttttccagcctcggt
tatccatcccgtcccgttaccatcaaaggaaaacaggcggcggccgcggtcggacaaaca
ctgttaatgcagcaatatatgaatcaatttaaacaatactcactgactccgggacaaatc
cttttaacgagaaatgatttttcgaaaagagaacggtatcgaaacgcgtatgctacgata
atggaattattagagcggggcgtcattccgattatcaacgagaacgattctacatctgtt
gaagaattgacattcggagataatgatatgctttctgcgttagtcagcggattgattcac
gcggaccagctcatgattctcactgacattaacggactgtatgatgccaatccaaatgaa
aatcctgaggcgaaacgatttgattatttgccagagatcacgcctgaattgcttggatat
gcaggttcagctggatcaaaggtcggcaccggcggaatgaaatcaaagctgttagccaca
caaaccgcgctgtctctgggagtgaaagtattcattggaactggcagcggagagcaaaaa
cttgcggacattttggacggcaggggagacggcacttatatcggagacaaagaactatct
tcggttaacaacacaaggcagtggattcagttccactcgccgatatcgggagaaattatc
attgatgcgggtgccgaagaggcgatgatccataatggaagcagccttttgcccgctgga
gttgtgggcgtgaacggaagctttccgaaaggggcggttgtggaagtcaggggaccgggc
ggcgtgatcggcaaaggccaaactcattactcctccgaggagattatggaggctaaaggc
aaacgcagtgacgaacttgattttgagaaaacgtttgaggttattcataggaatgactgg
gtcaatgtaaaagactag

DBGET integrated database retrieval system