KEGG   Bacillus subtilis subsp. subtilis 168: BSU13130
Entry
BSU13130          CDS       T00010                                 

Gene name
proA
Definition
(RefSeq) gamma-glutamyl phosphate reductase
  KO
K00147  glutamate-5-semialdehyde dehydrogenase [EC:1.2.1.41]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00330  Arginine and proline metabolism
bsu00332  Carbapenem biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01230  Biosynthesis of amino acids
Module
bsu_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    BSU13130 (proA)
  09110 Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    BSU13130 (proA)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.41  glutamate-5-semialdehyde dehydrogenase
     BSU13130 (proA)
SSDB
Motif
Pfam: Aldedh DUF166
Other DBs
NCBI-GeneID: 936166
NCBI-ProteinID: NP_389196
Pasteur: BG10964
BSORF: BG10964
UniProt: P39821 A0A6M4JJ65
Position
1379605..1380852
AA seq 415 aa
MSEVSVKAKLAKEAAAEMIMKTTAEKDEALSLIANGLRKELDFLLAENAKDIVNGKENGL
TPDIIDRLSLDEKRIRDIADAVELLIDLADPIGDSLETIEKENGLFIEKIRVPLGVVGMI
YEARPNVTVDAATLCLKTGNAVVLRGSSSAIHSNKALVSVIYRALEQSALPIHAVQLIED
TSRETAKELFTLNDGLDVLIPRGGKKLIDLVVRESTVPVLETGAGNCHIFIDETAKPQMA
EKVVVNAKTQRPSVCNAIESLLIHKAWARQHGKELLDQLENAGVEIRGDELVCELHPSSK
QASKEDWETEFLAPVLSVKTVENVQEAVKHIQQYGTNHSEAILTENDKNAVYFQTAVDAA
AVYHNASTRFTDGFEFGYGAEIGISTQKLHARGPMGLPALTSTKYIIKGTGQIRE
NT seq 1248 nt   +upstreamnt  +downstreamnt
atgagtgaagtttctgtaaaagcgaagctggcgaaagaagcagcagccgaaatgatcatg
aaaacaacagccgagaaggatgaggcgctcagcctcattgcaaacggactccgcaaagaa
ctggattttctcttggcggagaatgcaaaagacattgtgaacggaaaagagaatggttta
acaccggacatcattgaccgtctctcattggatgagaaacggatacgcgatatcgcggac
gcggtggagctcttaatcgacttagcggacccaatcggcgactctcttgaaacgattgaa
aaagaaaacggcctgtttattgaaaaaatccgtgtgccgctcggtgtcgtaggaatgatt
tatgaggcgaggccaaacgtcacagttgatgcggctaccctttgcctgaagacagggaac
gcggttgtgctgcggggaagctcctcagccatccacagcaacaaagcgctcgtcagtgtc
atttacagagcacttgagcaatcagcgcttccgattcacgctgtgcagctgattgaggat
acgagcagagagacagcaaaagagctctttacgttaaatgatggcttagacgtattgatt
ccgcgcggaggcaagaaactgattgatctcgttgtgagagaatcaacagttcctgtatta
gaaacgggagcaggaaactgccacatattcattgacgaaacagccaaaccgcaaatggca
gaaaaggttgttgtaaatgccaaaacgcagcgcccttctgtatgcaacgcgattgaatca
ttgctgattcacaaggcttgggcaagacagcacggaaaagaattgctggaccagctggaa
aacgcgggagttgaaattcgcggtgatgaattggtatgtgaacttcatccttcaagcaaa
caagcatcaaaagaagattgggaaaccgaatttttagcgcctgtcctcagcgtaaagacg
gttgaaaacgtccaagaagctgtaaagcatatccaacaatacggcaccaatcattctgaa
gcgattttaactgaaaatgacaaaaatgcggtatattttcaaacggctgtcgatgctgcc
gctgtctatcataacgcgtcaacccgctttaccgacggctttgaattcggctacggagcc
gaaatcggcatcagcacgcaaaagcttcatgcaagaggaccgatggggcttcctgcactg
acttctacaaaatacatcattaaaggaactgggcaaatccgtgaatag

DBGET integrated database retrieval system