KEGG   Bacillus subtilis subsp. subtilis 168: BSU13140
Entry
BSU13140          CDS       T00010                                 

Gene name
ohrA
Definition
(RefSeq) organic hydroperoxide resistance protein OhrA
  KO
K04063  lipoyl-dependent peroxiredoxin [EC:1.11.1.28]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU13140 (ohrA)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.28  lipoyl-dependent peroxiredoxin
     BSU13140 (ohrA)
SSDB
Motif
Pfam: OsmC
Other DBs
NCBI-GeneID: 939848
NCBI-ProteinID: NP_389197
Pasteur: BG13238
BSORF: BG13238
UniProt: O34762 A0A6M3ZF74
Position
1380978..1381403
AA seq 141 aa
MSQPLFTATVSAVGGREGKVISSDRVLELDVAMPGTPRAKKLEKATNPEQLFAAGYAACF
DSALQLVARTERVKVETEVTANVSLLKDEADQGYKLGVTLQVKGEGVSASELEALVKKAH
GVCPYSKATSGNIDVTLEVAE
NT seq 426 nt   +upstreamnt  +downstreamnt
atgagtcagccattatttaccgcaactgtttcagcggtaggaggaagagaaggaaaggtc
atttcatcagaccgcgttcttgagcttgatgtcgcaatgccggggacaccgagagccaag
aaattagaaaaagcgacaaatccagagcagctgtttgcagcaggttatgcagcttgcttt
gacagcgccctgcagcttgtcgcaagaacagaacgggtaaaagtagagacagaggttaca
gcaaatgttagcctgttaaaggatgaagcggaccagggctataagctgggtgtgacgctg
caagtaaaaggagaaggagtcagtgcatcagaattggaggcgcttgtgaaaaaagcgcac
ggcgtctgcccgtactcaaaagcaacctccggaaatattgatgtgacacttgaagttgct
gaataa

DBGET integrated database retrieval system