KEGG   Bacillus subtilis subsp. subtilis 168: BSU13150
Entry
BSU13150          CDS       T00010                                 

Gene name
ohrR
Definition
(RefSeq) organic hydroperoxide resistance transcriptional regulator
  KO
K23775  MarR family transcriptional regulator, organic hydroperoxide resistance regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU13150 (ohrR)
Transcription factors [BR:bsu03000]
 Prokaryotic type
  Helix-turn-helix
   MarR family
    BSU13150 (ohrR)
SSDB
Motif
Pfam: MarR MarR_2 HTH_27 PadR HTH_24 TrmB HxlR TFIIE_alpha HTH_34 Penicillinase_R Mga Fe_dep_repress PK HTH_20 HTH_Crp_2
Other DBs
NCBI-GeneID: 939850
NCBI-ProteinID: NP_389198
Pasteur: BG13239
BSORF: BG13239
UniProt: O34777 A0A6M3ZAH4
Structure
PDB: 
1Z91 1Z9C

Position
complement(1381434..1381877)
AA seq 147 aa
MENKFDHMKLENQLCFLLYASSREMTKQYKPLLDKLNITYPQYLALLLLWEHETLTVKKM
GEQLYLDSGTLTPMLKRMEQQGLITRKRSEEDERSVLISLTEDGALLKEKAVDIPGTILG
LSKQSGEDLKQLKSALYTLLETLHQKN
NT seq 444 nt   +upstreamnt  +downstreamnt
atggaaaataaatttgatcatatgaaattggagaatcagctttgttttttgctatatgcg
agttcgcgggagatgacaaagcaatacaagccgctgcttgataagctgaatataacatac
cctcaatatttggctttgcttttgttatgggaacatgaaacgcttactgtcaaaaaaatg
ggcgaacagctgtatttagattcaggaacgctcactccgatgcttaaacgaatggaacaa
cagggtttgattacgagaaaaagatctgaagaggatgagcggtccgtgttgatcagcctg
acagaggacggagcgttattaaaagaaaaagcggttgacattccagggacaattctgggg
ctctcaaagcagtctggggaggatctcaaacagttaaagtccgctctatatacattactg
gaaacacttcatcaaaaaaattga

DBGET integrated database retrieval system