KEGG   Bacillus subtilis subsp. subtilis 168: BSU13160Help
Entry
BSU13160          CDS       T00010                                 

Gene name
ohrB
Definition
(RefSeq) organic hydroperoxide resistance protein OhrB
  KO
K04063  lipoyl-dependent peroxidase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99975 Protein processing
    BSU13160 (ohrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OsmC
Motif
Other DBs
NCBI-GeneID: 936734
NCBI-ProteinID: NP_389199
Pasteur: BG19021
BSORF: BG19021
UniProt: P80242
Structure
PDB: 

Position
1382020..1382430
Genome map
AA seq 136 aa AA seqDB search
MALFTAKVTARGGRAGHITSDDGVLDFDIVMPNAKKEGQTGTNPEQLFAAGYAACFGGAL
EHVAKEQNIEIDSEIEGQVSLMKDESDGGFKIGVTLVVNTKDLDREKAQELVNAAHEFCP
YSKATRGNVDVKLELK
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggcactatttacagcaaaagtaaccgcgcgaggcggacgagcaggacatattacatca
gatgacggtgttcttgattttgatattgtcatgccaaatgccaaaaaagaaggacaaacc
ggcacaaatccggaacagctctttgcggcagggtatgctgcatgcttcggcggcgcgctc
gaacacgtagccaaagagcagaatatcgaaattgattcggagattgaagggcaggtcagc
ctcatgaaggatgagagcgacggcgggtttaaaatcggtgtcacacttgttgtgaacacg
aaagatttagatcgggaaaaggcacaagagcttgtcaacgccgctcatgaattctgtcct
tactcaaaggcaaccagaggaaatgttgatgtaaaactagaattaaaataa

DBGET integrated database retrieval system