KEGG   Bacillus subtilis subsp. subtilis 168: BSU13169
Entry
BSU13169          CDS       T00010                                 

Symbol
ykzN
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 8302905
NCBI-ProteinID: YP_003097717
UniProt: C0H400 A0A6M4JFF3
Position
1382457..1382627
AA seq 56 aa
MFFGVGHAGRAQIYDKTSEKRLKHAFKPKVTDEAGGWHGVCRAELRVYAVLYLHRA
NT seq 171 nt   +upstreamnt  +downstreamnt
atgttttttggtgtcggacatgcggggcgggcacagatttatgataaaacttcagagaag
cgtttgaagcatgcctttaaaccaaaagttacagatgaagcgggtggctggcacggtgtc
tgccgtgctgaattgcgcgtatatgctgttttgtatttgcacagggcatag

DBGET integrated database retrieval system