KEGG   Bacillus subtilis subsp. subtilis 168: BSU13180
Entry
BSU13180          CDS       T00010                                 

Symbol
metE
Name
(RefSeq) 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase
  KO
K00549  5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase [EC:2.1.1.14]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00270  Cysteine and methionine metabolism
bsu00450  Selenocompound metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01230  Biosynthesis of amino acids
Module
bsu_M00017  Methionine biosynthesis, aspartate => homoserine => methionine
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BSU13180 (metE)
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BSU13180 (metE)
Enzymes [BR:bsu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.14  5-methyltetrahydropteroyltriglutamate---homocysteine S-methyltransferase
     BSU13180 (metE)
SSDB
Motif
Pfam: Meth_synt_2 Meth_synt_1 zf-C4H2 Put_DNA-bind_N
Other DBs
NCBI-GeneID: 936480
NCBI-ProteinID: NP_389201
Pasteur: BG12616
BSORF: BG12616
UniProt: P80877 A0A6M3Z9X4
Position
complement(1383320..1385608)
AA seq 762 aa
MTTIKTSNLGFPRIGLNREWKKALEAYWKGSTDKDTFLKQIDELFLSAVKTQIDQQIDVV
PVSDFTQYDHVLDTAVSFNWIPKRFRHLTDATDTYFAIARGIKDAVSSEMTKWFNTNYHY
IVPEYDESIEFRLTRNKQLEDYRRIKQEYGVETKPVIVGPYTFVTLAKGYEPSEAKAIQK
RLVPLYVQLLKELEEEGVKWVQIDEPALVTASSEDVRGAKELFESITSELSSLNVLLQTY
FDSVDAYEELISYPVQGIGLDFVHDKGRNLEQLKTHGFPTDKVLAAGVIDGRNIWKADLE
ERLDAVLDILSIAKVDELWIQPSSSLLHVPVAKHPDEHLEKDLLNGLSYAKEKLAELTAL
KEGLVSGKAAISEEIQQAKADIQALKQFATGANSEQKKELEQLTDKDFKRPIPFEERLAL
QNESLGLPLLPTTTIGSFPQSAEVRSARQKWRKAEWSDEQYQNFINAETKRWIDIQEELE
LDVLVHGEFERTDMVEYFGEKLAGFAFTKYAWVQSYGSRCVRPPVIYGDVEFIEPMTVKD
TVYAQSLTSKHVKGMLTGPVTILNWSFPRNDISRKEIAFQIGLALRKEVKALEDAGIQII
QVDEPALREGLPLKTRDWDEYLTWAAEAFRLTTSSVKNETQIHTHMCYSNFEDIVDTIND
LDADVITIEHSRSHGGFLDYLKNHPYLKGLGLGVYDIHSPRVPSTEEMYNIIVDALAVCP
TDRFWVNPDCGLKTRQQEETVAALKNMVEAAKQARAQQTQLV
NT seq 2289 nt   +upstreamnt  +downstreamnt
atgacaaccatcaaaacatcgaatttaggatttccgagaatcggactgaaccgggaatgg
aaaaaagcacttgaagcgtattggaaaggcagtactgataaagatacgtttttgaagcaa
atcgacgaactatttttatccgcagtaaaaacacaaattgaccagcagattgatgttgtg
cctgtttctgatttcacacagtatgaccatgtactcgacacagcagtcagcttcaactgg
atcccgaaacggttcagacatttgactgacgctaccgatacatacttcgctatcgcccgc
ggaatcaaagacgctgtatctagtgaaatgacaaaatggtttaatacaaattaccattac
atcgttccggaatatgacgagagcattgagttccgtctgacaagaaacaaacaactcgaa
gattatcgccggatcaaacaggaatacggtgtggaaacaaagcctgtgattgtcggccct
tatacgttcgttacgcttgctaaaggctatgaaccgtctgaagcaaaagcgatccaaaaa
cgccttgtgccattatatgtacagcttttgaaagagcttgaagaagaaggcgtaaaatgg
gttcaaatcgatgagccggcgctcgttaccgcctctagtgaagatgtacgcggcgcaaaa
gaattatttgaaagcattacaagtgagctttcatccttgaatgtgcttttgcagacgtat
tttgattctgttgatgcttatgaagagctgatctcttacccggttcagggaattggcctt
gatttcgttcacgacaaaggcagaaacctggaacagcttaaaacacatggcttcccgaca
gataaagtgctggcagccggcgttatcgacggacgcaacatttggaaagcggaccttgaa
gagcgtctcgatgccgttcttgatattctcagcattgcaaaagttgatgaactgtggatt
cagccttccagcagcctgctgcatgttccagtagcgaaacaccctgatgagcatttggaa
aaagacctattgaacggattatcctacgcaaaagaaaagctggccgagctgacagctttg
aaagaaggcttagtatcaggaaaagcggcgatcagcgaagagattcagcaggctaaggct
gatatccaggcgcttaaacagtttgcaacaggcgccaattctgaacaaaagaaagagctt
gagcaattaactgataaagacttcaagcgcccgattccgtttgaagaacgtttagcccta
caaaatgaatctctcggccttccgcttttgccgacgacaacgatcggcagcttcccgcag
tctgctgaagtgcggagcgcacgccaaaaatggcggaaagctgagtggtccgatgaacag
tatcaaaactttatcaatgcggaaacaaaaagatggattgatattcaggaagaattggag
cttgatgtccttgttcacggcgaatttgaacggacagacatggtcgaatacttcggtgaa
aagctggccggtttcgccttcactaaatatgcctgggttcaatcatacggctcacgctgt
gtccgcccgccagtcatttacggagatgttgaatttattgaaccgatgacagtgaaagac
acagtctacgcacagtcattgacttccaagcatgtgaaaggaatgctgacgggcccggtt
acaatcttaaactggtctttccctcgaaacgacatctcgaggaaagaaatcgccttccaa
atcgggcttgcccttcgcaaagaagttaaagcgcttgaagacgcaggcattcaaatcatt
caagtcgatgaaccagcgctgcgtgaaggccttccattgaaaacccgcgattgggatgag
tatttgacttgggcggcagaagctttcagattaaccacttcttccgtgaaaaacgagaca
caaattcatacacatatgtgctacagcaacttcgaagatatcgttgatacaatcaatgat
cttgatgccgatgtgattacaatcgaacatagcagaagccacggaggatttttagattac
ttaaaaaaccacccgtatttgaaagggcttggccttggtgtatatgacattcacagccct
cgtgtgccgtcaactgaagaaatgtacaatattatcgttgatgcgcttgccgtctgtccg
actgaccgcttctgggtaaatccagactgcggattgaaaacaagacagcaggaagaaacg
gttgcagcattgaaaaatatggttgaagccgcaaaacaggcaagagcacagcagacacag
ctagtataa

DBGET integrated database retrieval system