KEGG   Bacillus subtilis subsp. subtilis 168: BSU13200
Entry
BSU13200          CDS       T00010                                 

Gene name
rsbRB
Definition
(RefSeq) RsbT co-antagonist protein RsbRB
  KO
K17763  rsbT co-antagonist protein RsbR
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:bsu03021]
    BSU13200 (rsbRB)
Transcription machinery [BR:bsu03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    RNA polymerase-associated proteins
     BSU13200 (rsbRB)
SSDB
Motif
Pfam: STAS STAS_2 PRESAN
Other DBs
NCBI-GeneID: 938160
NCBI-ProteinID: NP_389203
Pasteur: BG12609
BSORF: BG12609
UniProt: O34860 A0A6M3Z9Z8
Position
1387206..1388039
AA seq 277 aa
MKLNEKLYAFFSEHVEQMAEEWIETMEESDPNSLYALHNATVTEELKEQDREFYRHLNYM
YVLPEKQFLEEFQEWVIELTNDQKHLDTPVQYVIREFMRNRRLYTKYFEKFAEENESAFE
PGEKQKWADLIVKVFDFTIYTFVDHAEMNAKQQLNAQREMILELSSPVITLSKSTALLPL
VGDIDTERAKFILENTLQACAKRRVEHLLIDLSGVVVVDTMVAHQIFKLIEALNLIGVRS
TLSGIRPEIAQTAVQLGIDFSNITIKTNLAQALNYHQ
NT seq 834 nt   +upstreamnt  +downstreamnt
atgaaactgaatgaaaaattatatgcatttttttcagagcatgtggaacaaatggccgag
gaatggattgaaacgatggaggaaagtgatccgaattcgctttacgccctacataatgca
acagtaacggaagaattgaaagagcaggacagagaattttaccggcatctgaattacatg
tatgttttaccggaaaaacaatttctcgaagagtttcaagagtgggtcattgagctgacc
aacgatcaaaaacatctcgacacaccggttcagtatgtcattcgggagtttatgagaaac
aggagattatatacgaagtattttgagaagttcgcagaagaaaatgaatcagcgtttgaa
ccgggagagaagcaaaaatgggcagatttgattgtaaaagtatttgatttcaccatttat
acattcgttgatcacgctgaaatgaatgccaagcagcaattaaacgcccaaagagaaatg
atattggaattaagctcacctgtcattaccctgagcaaatcaacagctctgctgccgctt
gtcggtgacattgataccgaacgggcgaagtttattctggaaaacacgcttcaagcttgt
gcgaaaagacgtgtggagcatctgttaatcgatctgtcaggtgttgttgtggtggatacg
atggtggcgcaccagatctttaaattgattgaggcgcttaatctgatcggtgtccggtca
accctgtcaggaatcaggcctgaaattgcgcaaactgctgtacagctggggattgacttt
tcgaatattactattaaaaccaaccttgcccaagcattaaactatcatcaataa

DBGET integrated database retrieval system