KEGG   Bacillus subtilis subsp. subtilis 168: BSU13210
Entry
BSU13210          CDS       T00010                                 

Gene name
thiX
Definition
(RefSeq) HMP/thiamine permease protein YkoC
  KO
K16785  energy-coupling factor transport system permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU13210 (thiX)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU13210 (thiX)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Energy-coupling factor transporter
    BSU13210 (thiX)
SSDB
Motif
Pfam: CbiQ
Other DBs
NCBI-GeneID: 939836
NCBI-ProteinID: NP_389204
Pasteur: BG13248
BSORF: BG13248
UniProt: O34572 A0A6M3ZDF8
Position
complement(1388070..1388834)
AA seq 254 aa
MKQPLHLINPTVKAAAVFCCVVMLSFIYNPYTPACFYIIIVAGVLLAAGIPLKKWLLFTI
PFLILAFGCVWTAAVFGKVPTTPDNFLFQAGPISINSDNVSVGISLGFRILCFSALSMMF
VFTTDPILFMLSLVQQCRLSPKLAYGVIAGFRFLPLLKDEVQLIQQAHKIRGGAAESGII
NKISALKRYTIPLLASAIRKAERTALAMESKGFTGSRNRTYYRTLSVNRRDWVFFCLVLL
LFAGSFLVSLCFAS
NT seq 765 nt   +upstreamnt  +downstreamnt
atgaagcaaccgttacatctcattaatccgactgtgaaagcggcggcggttttttgttgt
gtcgtcatgctgtcgtttatttacaacccttacactccggcatgtttttatatcatcatc
gttgcgggcgttttactggcggccggaatcccattgaaaaaatggttgttgtttacgatt
ccgtttttgattttagcattcggatgcgtgtggacagccgcagtttttggaaaagtgccg
acaacaccggataattttttgtttcaagcaggccctatctccattaacagcgataatgtg
tctgtcggcatctctctcgggtttcgtattttatgcttttccgccttatcgatgatgttt
gtttttacaaccgatccgattctatttatgctgagccttgtccagcagtgcaggctctca
ccaaagctcgcgtacggtgtcattgcaggctttcgctttcttccgctgttaaaggatgag
gtccagctgattcagcaggctcataaaatcagaggaggagcggcggagagcggcatcatt
aataaaatcagtgcgttaaaacgatataccataccgctattggcaagcgccatcagaaaa
gcggaacggacagcgcttgcgatggaatcgaaaggatttacaggaagcagaaaccggaca
tactacaggacattgagcgtgaaccggcgcgactgggtgttcttttgcctcgtcctctta
ttattcgcgggatcctttctcgtatctttatgtttcgcatcataa

DBGET integrated database retrieval system