KEGG   Bacillus subtilis subsp. subtilis 168: BSU13220
Entry
BSU13220          CDS       T00010                                 

Symbol
thiW
Name
(RefSeq) HMP/thiamine import ATP-binding protein YkoD
  KO
K01552  energy-coupling factor transport system ATP-binding protein [EC:7.-.-.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU13220 (thiW)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Energy-coupling factor transporter
    BSU13220 (thiW)
SSDB
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_29 RsgA_GTPase AAA_16 AAA_22 AAA_25 AAA_23 AAA_5 AAA_15 AAA_30 Mg_chelatase SbcC_Walker_B TniB IstB_IS21 RNA_helicase AAA PhoH Rad17 AAA_18 ATPase_2 NACHT AAA_28 AAA_33 AAA_27 SRP54 AAA_11 T2SSE
Other DBs
NCBI-GeneID: 936472
NCBI-ProteinID: NP_389205
Pasteur: BG13249
BSORF: BG13249
UniProt: O34362 A0A6M4JJ73
Position
complement(1388809..1390452)
AA seq 547 aa
MQAFDELLTVEQLSFSYEEDEKPVFQDISFELQKGECVLLLGPSGCGKSSLALCLNGLYP
EACDGIQSGHVFLFQKPVTDAETSETITQHAGVVFQDPDQQFCMLTVEDEIAFGLENLQI
PKEEMTEKINAVLEKLRITHLKEKMISTLSGGQKQKVALACILAMEPELIILDEPTSLLD
PFSAREFVHLMKDLQREKGFSLLVIEHQLDEWAPWIERTIVLDKSGKKALDGLTKNLFQH
EAETLKKLGIAIPKVCHLQEKLSMPFTLSKEMLFKEPIPAGHVKKKKAPSGESVLEVSSL
SFARGQQAIFKDISFSLREGSLTALVGPNGTGKSTLLSVLASLMKPQSGKILLYDQPLQK
YKEKELRKRMGFVFQNPEHQFVTDTVYDELLFGQKANAETEKKAQHLLQRFGLAHLADHH
PFAISQGQKRRLSVATMLMHDVKVLLLDEPTFGQDARTAAECMEMIQRIKAEGTAVLMIT
HDMELVSSYADSVLVLHDTGLAFDGSPAQLFSQETGLVQKAKLTLPLLYEWMAFQEEVRD
EATVTSH
NT seq 1644 nt   +upstreamnt  +downstreamnt
atgcaagcctttgatgagcttctgacggttgagcagctcagcttctcttatgaagaagac
gagaaaccggtttttcaagacatttcgtttgagcttcaaaaaggagaatgtgttttatta
ttaggaccgagcggatgcggtaaaagctcgctcgccctttgtttaaacggtctatatccg
gaggcttgcgacggcattcagtccggacatgtatttctatttcaaaagccggtcacagat
gctgaaacctccgaaacgattactcagcatgccggggtcgtttttcaggatcctgatcag
cagttctgcatgctgacggtggaggacgaaatagcgttcgggctggaaaatctgcaaatt
ccaaaagaagaaatgacagagaaaatcaacgccgtattagaaaaattacgcattacccat
ttaaaagaaaaaatgatctcaaccctttcaggaggacaaaagcagaaagtggctctcgcc
tgtattttggcgatggagcctgagcttattattttagatgagccgacctctcttttagac
cctttctcagctcgggagttcgttcatctgatgaaggatcttcagcgggaaaaaggtttc
agcctcctcgtcattgagcaccagcttgatgaatgggcgccttggattgagagaacgatc
gtactcgacaaatcaggcaaaaaggcactggatggcctgacgaaaaatctatttcagcat
gaagcggagacactaaagaaattgggcatcgccattccaaaggtctgtcatctgcaggaa
aagctgagtatgccgtttactttatcaaaagagatgctgttcaaagagcctattcctgcc
gggcatgtcaaaaagaagaaagccccttctggggagagtgtgcttgaagtcagcagcctt
tcgttcgcgagaggacagcaggcgattttcaaagacatcagcttttcgttgcgcgaaggc
tctttaacggcgcttgtcggtccgaacggaactggaaaatcgacgctcctatcagttctg
gccagtctcatgaaaccgcaaagcggcaaaatccttctctatgatcagccgctgcagaaa
tataaagaaaaagaattgcgtaaacggatgggatttgtttttcaaaaccctgagcatcaa
ttcgtcaccgatacggtgtatgacgagcttctgttcggccagaaagcaaatgctgaaact
gagaaaaaagcgcaacacctgctgcagcgttttggtcttgcgcatttggctgatcatcat
ccgtttgcgatcagccaagggcaaaaacggcgactgagcgtagctactatgctcatgcat
gacgtaaaggttttattattagacgaaccaacctttggccaggatgcccgcacggcggct
gaatgcatggaaatgattcaacgtatcaaggcagagggaactgctgtccttatgattaca
cacgatatggagctagtctcttcgtatgctgacagcgtgcttgtgcttcacgatacaggc
ctggcctttgacggatctccagcgcagttgttttctcaagaaacagggcttgttcaaaaa
gcaaagctcacccttccccttctatatgaatggatggcatttcaagaggaggtgcgtgat
gaagcaaccgttacatctcattaa

DBGET integrated database retrieval system