KEGG   Bacillus subtilis subsp. subtilis 168: BSU13250
Entry
BSU13250          CDS       T00010                                 

Gene name
ykoG
Definition
(RefSeq) transcriptional regulator
  KO
K02483  two-component system, OmpR family, response regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bsu02022]
    BSU13250 (ykoG)
Two-component system [BR:bsu02022]
 OmpR family
  Unclassified
   BSU13250 (ykoG)
SSDB
Motif
Pfam: Response_reg Trans_reg_C FleQ
Other DBs
NCBI-GeneID: 936451
NCBI-ProteinID: NP_389208
Pasteur: BG13252
BSORF: BG13252
UniProt: O34903 A0A6M4JL09
Position
1391953..1392639
AA seq 228 aa
MEKGHILIVEDEEKIARVLQLELEYEGYSVTIKHNGTEGLDAAAEGGYSLVLLDVMLPGL
SGLEVLRRLRKTDSQTPVILLTARDSIPDKVTGLDIGANDYVTKPFEIEELLARIRAALR
QNGTKTEDIGTFLTYDDLRVNEKTREVRRGDKEVELTPREFDLLVYMLKHPQQVLTREQI
LSSVWGFDYIGDTNVVDVYIRYIRKKLDYPYEKQLIHTIRGVGYAIKG
NT seq 687 nt   +upstreamnt  +downstreamnt
ttggaaaaaggacacatattaattgtggaagatgaagaaaaaatcgccagggttcttcag
cttgaattggaatatgaaggatacagcgtcacgatcaaacacaatggcacagaaggtctt
gatgcggcagcggaaggcgggtattccttggtgcttcttgatgtcatgcttccggggctt
agcggactggaagtgctgcgccgcttgagaaaaacggattcgcagacaccggtcatatta
ttaacggcgcgagacagtattcctgataaggtaacaggtctggacatcggtgcaaatgac
tatgtcaccaagccgtttgaaatcgaggaattgcttgcgagaatcagggcggcgctgcgg
caaaatggaacaaaaactgaagatatcggcacctttcttacatatgacgatttgcgggtg
aacgaaaaaacccgtgaagtgagacgcggagacaaagaggtggaattaacgccgcgggaa
tttgatctgctcgtctatatgctaaagcatccgcagcaagtgctgacacgggagcaaatt
ctaagctcagtatggggatttgattatatcggtgatacaaatgtcgtggacgtctacata
agatacatcagaaaaaaactggactatccttacgaaaaacagctgatccatacgattcgc
ggggtcggctatgccattaaggggtaa

DBGET integrated database retrieval system