KEGG   Bacillus subtilis subsp. subtilis 168: BSU13260
Entry
BSU13260          CDS       T00010                                 

Gene name
ykoH
Definition
(RefSeq) sensor histidine kinase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: HATPase_c HisKA HAMP ArlS_N HATPase_c_2 DUF4094 HATPase_c_3
Other DBs
NCBI-GeneID: 936458
NCBI-ProteinID: NP_389209
Pasteur: BG13253
BSORF: BG13253
UniProt: O34638 A0A6M4JFG2
Position
1392643..1394007
AA seq 454 aa
MKLKTKIHLYTSISLLILLILVHTAVYLIFSSALTSKDAARLADETDNIAEALRAAETEG
VALQDMLQAYLPANGMVRVVNGDQKAVMTITKEKAYKDFPLSFHSGETADVRKPDGKLFA
EAAVPVIWTDGQVVSLQLVERLENTEESLFLLKIILIAASAAVCIASFFAGSLLARRIIN
PIRRLMITMKDIQRDKEFKTISLEGQSNDELYQMGLTFNEMAMMLKEHYDKQQQFVQDAS
HELKTPLTIIESYSSLMKRWGAKKPEVLEESIEAIHSEAVHMKKLTNQLLALAKSHQGLE
VDLKTIDLIKAARAVMQTLQSVYQRDILLETDKESLLVKADEERIKQLLTILLDNAIKYS
EKPIEMSAGTRNGRPFLSVRDEGIGIPEEHIPHLFERFYRADEARNRKTGGTGLGLSIAK
QIADEHGIELSVKSKPGQGTAVTMQFSEQNGGGR
NT seq 1365 nt   +upstreamnt  +downstreamnt
atgaagctgaagaccaagattcatctatacacttcgatatcactgttgattttattaatt
ttggttcataccgcagtatatctcattttttcgtctgcgctgacatcaaaggatgcggcc
cggcttgctgatgagacggataacattgccgaagcgctgcgtgccgctgaaacagaagga
gtggctttgcaggatatgctgcaggcctatcttccggcaaatggcatggtgcgtgtagtg
aatggtgatcaaaaagccgttatgacgatcacaaaagaaaaagcctataaagattttcct
ctctcttttcatagcggcgaaacggcagatgtgaggaaacctgacggcaagctgtttgcc
gaggctgctgttccggtgatttggaccgatggacaagtcgtgtctcttcagctggttgaa
agactggagaacacagaagagagtctgtttctgctgaaaatcatcttaatcgctgcaagt
gctgctgtctgcattgcttctttttttgcaggcagcttgctagcccgccgaatcatcaat
ccgatcagacgattaatgatcacaatgaaagacatacagcgagacaaagaatttaaaacg
atttctttagaaggacagtccaacgatgaattgtatcaaatggggctgacatttaatgaa
atggcaatgatgctgaaggagcactatgataaacagcagcaatttgttcaagatgcttca
cacgaattgaaaaccccgctcactattatagaaagctacagcagcctgatgaagcggtgg
ggtgcaaaaaagccggaggtgcttgaggagtcgatagaagccattcactcagaagcggtg
catatgaaaaaactgaccaatcagcttttggcgctggccaaaagccatcaaggactcgag
gttgatctgaaaacaatcgatctgattaaagcggcgcgcgcggttatgcaaacgctccag
tccgtttatcagcgtgacatattgcttgaaacagataaagagagcctgcttgtaaaggca
gatgaagaacgcatcaagcagctgttgaccattttgcttgataatgcaataaagtatagt
gaaaagcctattgagatgtcagccggaacgaggaatggacggccatttctatcagtgagg
gatgaaggcatcggaatacctgaggagcatatcccgcatttgttcgaacggttctaccgg
gcagatgaggcacgaaacagaaaaacaggcggaacaggtttaggcctttccattgccaag
caaatcgctgatgagcatggcattgagctgtctgtcaaaagcaagccgggacaaggaaca
gctgtcaccatgcaattcagcgaacagaatgggggaggccgatga

DBGET integrated database retrieval system