KEGG   Bacillus subtilis subsp. subtilis 168: BSU13270
Entry
BSU13270          CDS       T00010                                 

Gene name
ykoI
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: PepSY PepSY_like DUF4179 DUF5604 PBP-Tp47_a
Other DBs
NCBI-GeneID: 939827
NCBI-ProteinID: NP_389210
Pasteur: BG13254
BSORF: BG13254
UniProt: O34551 A0A6M3Z9U5
Position
1394004..1394684
AA seq 226 aa
MTKTIKTVSFAAAAILVVIICTFLIIRQTHENVLSKETVVKKVEASYEGKVTKATQSKDK
KTYDITLENPKGTYFVKADAISADILSMNRVKAVNPSAMTEKEAEHLALERVPGTVKKQT
RQSQVATYTIQKEDGKTYEVKVDMQAKTVLSADQISSKDQQKTPITKKEAKTIAERKTGG
TADDADLEESEGTLIFEVDVDLPDNKEATVKINAYTGKVANIVYED
NT seq 681 nt   +upstreamnt  +downstreamnt
atgactaaaacaataaaaacagtatcttttgctgcagcagccattttagttgtcatcatc
tgtacgtttctcatcattcggcaaacccatgagaacgtattgtcaaaggagactgtcgta
aaaaaagtcgaagcctcttatgaaggcaaggtcacgaaagcaacacaatcaaaggataaa
aaaacatatgatataacccttgaaaatccaaagggaacttactttgtaaaagcagacgca
atatcggctgacattctttcaatgaatagagtaaaagcagtgaatccatctgccatgaca
gaaaaagaagccgagcatctcgcgcttgagcgggtgccgggaacggtcaaaaaacaaaca
cggcaaagtcaagttgccacttataccatacaaaaagaagacgggaaaacatacgaagtg
aaggtagacatgcaggcaaaaacagtcttgtctgccgatcaaatcagcagcaaagatcaa
caaaaaacgccgattacgaaaaaagaagccaaaacaattgcagagcgaaaaacgggcgga
acagcggatgacgcagatctcgaagaaagtgagggcactctcatctttgaagtagacgtt
gatcttcctgataataaggaagcgacagtgaaaatcaatgcctacacaggaaaggtagct
aacattgtgtatgaagactga

DBGET integrated database retrieval system