KEGG   Bacillus subtilis subsp. subtilis 168: BSU13280Help
Entry
BSU13280          CDS       T00010                                 

Gene name
ykoJ
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PepSY PepSY_2 CNP_C_terminal BCAS3 DUF917 NusG_II
Motif
Other DBs
NCBI-GeneID: 936459
NCBI-ProteinID: NP_389211
Pasteur: BG13255
BSORF: BG13255
UniProt: O35012
Position
1394776..1395288
Genome map
AA seq 170 aa AA seqDB search
MLKKKWMVGLLAGCLAAGGFSYNAFATENNENRQASSKTDALTEQEAEAIAKTVVDGTVE
DIDRDLYNGKEVYEVEIEKEGEDYDVYVDIHTKQALNDPLKEKAEQVAITKEEAEEIALK
QTGGTVTESKLDEDDGAYIYEMEIQTKQGTETEFEISAKDGRIIKQEIDD
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgctcaagaaaaaatggatggtcggtcttttagcagggtgcctagcggccggaggattc
agctacaacgcgtttgccacagaaaacaatgaaaacagacaggcttcttctaagacggat
gcactcactgaacaagaagcagaagcaattgctaaaacagttgttgacggcacagtagaa
gacattgacagagacctttacaacggcaaagaagtctatgaagtggagattgaaaaagaa
ggtgaagactacgacgtttatgtagatattcatacaaaacaagcgcttaatgacccgtta
aaggagaaagcagaacaagtcgccataaccaaagaagaagctgaagaaattgctttaaag
caaacaggtggaaccgtaacagaaagtaagcttgacgaagatgacggtgcttacatctat
gaaatggaaatccaaacgaagcaaggaactgagacagaatttgaaatttccgcaaaagat
ggacgcattatcaaacaggagatagatgactaa

DBGET integrated database retrieval system