KEGG   Bacillus subtilis subsp. subtilis 168: BSU13290Help
Entry
BSU13290          CDS       T00010                                 

Gene name
ykzD
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SplA
Motif
Other DBs
NCBI-GeneID: 936450
NCBI-ProteinID: NP_389212
Pasteur: BG13332
BSORF: BG13332
UniProt: O34405
Position
1395371..1395508
Genome map
AA seq 45 aa AA seqDB search
MEKKEEQYINQAEYVPHPTKEGEYALFLHETYHLLSEDDETQTTE
NT seq 138 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagaaagaggagcaatacatcaatcaggctgaatatgtccctcatccgacgaag
gaaggagagtatgccttatttcttcatgaaacgtatcatttgctttctgaagatgacgag
acacaaacaacagaataa

DBGET integrated database retrieval system