KEGG   Bacillus subtilis subsp. subtilis 168: BSU13300
Entry
BSU13300          CDS       T00010                                 

Gene name
mgtE
Definition
(RefSeq) magnesium transporter MgtE
  KO
K06213  magnesium transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU13300 (mgtE)
Transporters [BR:bsu02000]
 Other transporters
  Pores ion channels [TC:1]
   BSU13300 (mgtE)
SSDB
Motif
Pfam: MgtE MgtE_N CBS FliG_C
Other DBs
NCBI-GeneID: 936439
NCBI-ProteinID: NP_389213
Pasteur: BG13256
BSORF: BG13256
UniProt: O34442 A0A6M3ZA02
Position
1396013..1397368
AA seq 451 aa
MVQNMTYDELILRIIILLRDGKIRDFRSVIDELQPYDMAFIFKEMPEKHRARYLSYLTVD
DITDMIGELEREFQLVVLNKVGKTKATLAMNKMDNDDLAQLLEEMDEELKEQLLSSMEAS
ESKAVQLLMNYPADSAGRMMTNRYVWIPQHYTVKDAVVKLKSFAEIAESINYLYVINESK
QLVGVLSYRDLILGEPEEKVQDLMFTRVISADALQDQEEVARLIERYDFLAIPVVEENNV
LVGIVTVDDIIDVVIREADEDYEKFAASGKDITFDTKAYVAAYRRLPWLILLLFIGLISG
SIISYFEDALKQVVALAFFMPMVSGMTGNTGTQSLAVVIRGLSKEEMNKKTIVRLIFREF
RTSIFIGAVCSVLIAIVSIIWQGNALLGFVVASSLFLTLIIGTMSGTIIPIILHKLKVDP
AIASGPLITTLNDILSLLIYFGIATAFIHSL
NT seq 1356 nt   +upstreamnt  +downstreamnt
atggttcaaaacatgacctatgacgaactcattttacgcatcattattttactgcgagac
gggaaaatcagggattttagaagtgttattgatgagcttcagccctatgacatggcattt
atttttaaagaaatgccggaaaaacatcgcgcccgctatttatcttatttaactgtagac
gatatcactgatatgatcggggagctggaacgcgaatttcagcttgtcgtcttaaataaa
gtcggaaaaacaaaagcaacactggcgatgaacaaaatggacaacgatgacctcgctcaa
ttgcttgaagaaatggacgaagaactgaaggaacagcttttatccagcatggaagcgtca
gaatcaaaagctgtacagctcttgatgaattacccggctgattcagcgggacgcatgatg
acaaaccggtatgtgtggatccctcagcattacacggtaaaagacgcggtcgtcaaactg
aaaagcttcgctgaaatagctgaatcgatcaactacttatatgttattaatgaaagcaaa
cagctggttggggttctttcctaccgcgatttgattctgggtgaacctgaagaaaaggtg
caggatttaatgtttacccgcgtcatatcagcagatgctcttcaggaccaggaagaagtt
gcccgcctgatagaacgttacgattttttggcaataccggttgtagaagaaaacaacgtg
cttgtcggcattgtgacggttgatgatattatcgacgttgttattcgggaagctgatgag
gattacgaaaaatttgccgcttccggtaaagacatcacctttgacacaaaagcttacgtg
gcggcataccggcgtctgccatggctgattttactcttatttatcggactgatttcagga
agcattatcagctattttgaagacgcgctgaagcaggttgtcgcgcttgcgtttttcatg
ccgatggtgtcagggatgacaggaaatacgggaacacaatctcttgcggttgtcatcaga
ggtttgtctaaagaagaaatgaacaaaaaaacgattgtgcgcctgatcttccgggagttc
agaacaagcatttttatcggagcggtttgttctgtgctgattgcgattgtttctatcata
tggcaggggaatgcgcttttgggatttgttgtcgcctcttcactgttcttaaccttaatc
atcggcacgatgtcaggaacgattatccctattattttgcacaaactgaaagtagacccg
gcgattgcttctggaccgctgattacaacgttaaacgatattttatctttattaatctac
tttggcattgccactgcattcattcactcattataa

DBGET integrated database retrieval system