KEGG   Bacillus subtilis subsp. subtilis 168: BSU13320
Entry
BSU13320          CDS       T00010                                 

Symbol
ykzB
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 939392
NCBI-ProteinID: NP_389215
Pasteur: BG13330
BSORF: BG13330
UniProt: O34923 A0A6M3ZA97
Position
1397938..1398093
AA seq 51 aa
MEEEKAVSLAKEIIELDIKRDEMLETFMQLAGEQAFQLLRSVQNGQYRKSS
NT seq 156 nt   +upstreamnt  +downstreamnt
atggaggaagaaaaagcagtctcactggcaaaagaaattatagagttggatatcaagcgt
gatgaaatgctggagacgtttatgcagcttgccggagaacaggcttttcaattattaaga
tcggttcaaaacggacaataccgaaaatcttcgtaa

DBGET integrated database retrieval system