KEGG   Bacillus subtilis subsp. subtilis 168: BSU13330Help
Entry
BSU13330          CDS       T00010                                 

Gene name
ykoL
Definition
(RefSeq) stress response protein YkoL
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fur_reg_FbpA
Motif
Other DBs
NCBI-GeneID: 939391
NCBI-ProteinID: NP_389216
Pasteur: BG13257
BSORF: BG13257
UniProt: O34763
Position
1398181..1398363
Genome map
AA seq 60 aa AA seqDB search
MSNLLKSALEKERRHYSEKLYQIGVYNKEVMNKMTISELRKEYAYFFRSITNHKNYPYTR
NT seq 183 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatttattgaaatccgctttagaaaaagaacgacgccattattctgaaaaactc
tatcagataggggtttataataaagaggtcatgaacaaaatgacgatttctgagcttcgg
aaagaatacgcttatttctttcgaagcattacaaatcataaaaattatccttatacaaga
taa

DBGET integrated database retrieval system