KEGG   Bacillus subtilis subsp. subtilis 168: BSU13340
Entry
BSU13340          CDS       T00010                                 

Symbol
ykoM
Name
(RefSeq) MarR family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: MarR HTH_27 MarR_2 HTH_34 TrmB HTH_24 PadR DUF3116 DUF2513 HTH_45 DUF4423
Other DBs
NCBI-GeneID: 939824
NCBI-ProteinID: NP_389217
Pasteur: BG13258
BSORF: BG13258
UniProt: O34949 A0A6M4JMD4
Position
1398496..1398960
AA seq 154 aa
MMRLSFNEEEVERAMNLYRVFARAFKSVSEHSIRDSKEHGFNPTEFAVLELLYTRGPQKL
QQIGSRLLLVSGNVTYVIDKLERNGFLVREQDPKDKRSVYAHLTDKGNEYLDKIYPIHAL
RIARAFSGLSPDEQDQLIVLLKKAGIHSQHLLFR
NT seq 465 nt   +upstreamnt  +downstreamnt
atgatgagattatcgtttaacgaagaagaagttgagcgtgcgatgaatttgtacagagtt
tttgcaagggctttcaaaagtgtgtccgaacatagtatccgtgatagcaaagagcacggt
tttaatcccactgaatttgctgtactggaactcctgtacacaagaggcccgcaaaaatta
cagcaaattgggtcgagacttctgcttgtaagcggaaacgtcacatatgttattgacaaa
ctagaaagaaacgggtttttagtaagggagcaggacccgaaagataaacgctctgtttac
gcacatttaactgacaagggaaatgagtatttggataaaatttatccgattcatgcactg
cgtattgcgagagcgttttcaggtctttcgcctgatgaacaggaccagctgatcgtcctg
ctcaagaaagcaggcatacacagccagcatttgctgtttcgttaa

DBGET integrated database retrieval system