KEGG   Bacillus subtilis subsp. subtilis 168: BSU13350
Entry
BSU13350          CDS       T00010                                 

Symbol
ykoN
Name
(RefSeq) glycosyltransferase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: MGDG_synth Epimerase_2 Inhibitor_I9
Other DBs
NCBI-GeneID: 939390
NCBI-ProteinID: NP_389218
Pasteur: BG13259
BSORF: BG13259
UniProt: C0SPB9 A0A6M3ZAB7
Position
complement(1398975..1400096)
AA seq 373 aa
MKNILIFPFLSISTGHHHVADALQAELESQGLAAEKIDIFSHSYRRLEKLSSVAYLKWIQ
YFPKTYSGIYRLLACGEFQHDKRYFMYEWLFTQQMRHILQEKQPDIAFCTHALPSYLLNR
LKPEYPNLTVVNVYTDFFVNQLWGRKNIDYHFVPSTEVKKQLISEGIDQNNIYLTGIPVH
QNFEMESADTLQHHPPYTIIITGGSMGVGGILKWVQELSPGGKILYKILCGRNEKLYSYV
KSLHHPLIEAIPYLHSKAEMNRLYEQATGIMTKPGGVTISECLQKRLPVFIYHALPGQEE
MNLNLLHERKLVTDMRNWDMQKAEEYIAAFFQSNEQMKEYKKHVNGYLGEMSDRKIKDVL
KRIIWKQKNTLLK
NT seq 1122 nt   +upstreamnt  +downstreamnt
atgaaaaacattctcatttttccttttttaagcatttccaccggccatcatcatgtggct
gatgcattgcaggctgaattagagtctcaagggctggcagctgaaaagattgatatcttt
tcacattcgtataggcggttagaaaaattgtcctccgtggcttatttaaaatggattcaa
tatttcccgaaaacgtacagcggcatttacaggctcctcgcctgcggagaatttcagcat
gacaaacgctatttcatgtacgaatggctgttcacacagcaaatgaggcacatcctccaa
gaaaaacagcctgatatcgccttctgcacacatgcgctgccttcttatctgctgaaccga
ctaaagcctgaatatccgaatctgacggttgtgaatgtatacactgattttttcgtgaat
caattatggggacggaagaacattgattaccattttgttccgagcacggaagtaaagaag
cagctaatatcagagggtatcgatcagaacaacatatacttgaccggcattccagttcac
caaaattttgaaatggaatcagcagataccttgcagcaccacccgccatataccatcatc
atcacagggggcagtatgggggtcggtgggattttaaaatgggtgcaggaactgtcgcca
ggcggaaagatcttatacaaaatattatgcggcagaaacgaaaagctctactcctatgtc
aaaagtttacaccaccccttgattgaggcgattccttaccttcacagcaaagcagagatg
aaccgtttgtacgaacaggcgacaggcatcatgactaaacccggaggcgtgaccatcagt
gaatgcttacagaaacggcttccggtatttatttatcatgcactgccgggacaggaggaa
atgaatttaaaccttctacatgaaaggaaactcgtcacagatatgagaaactgggacatg
cagaaagcagaagagtatatcgcggcattttttcaatcgaacgaacagatgaaggagtat
aaaaaacacgtcaatggataccttggcgaaatgtctgataggaagattaaagatgtttta
aaaagaatcatatggaaacaaaaaaacactctcctgaaatag

DBGET integrated database retrieval system