KEGG   Bacillus subtilis subsp. subtilis 168: BSU13360
Entry
BSU13360          CDS       T00010                                 

Gene name
ykoP
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 936444
NCBI-ProteinID: NP_389219
Pasteur: BG13260
BSORF: BG13260
UniProt: O34495 A0A6M4JFH0
Position
1400188..1400739
AA seq 183 aa
MKTCFLSIWRVVDPIYFFFSRLSLIDNDQKSVFRVRLTKYKGHHVVLSDGTHIRKNDVLV
KIHLHNIKLIRELQSIESAVRKGIIIYQKVYQSMPLLLDYINNHKKSEKIKGIIGITMLD
KGVERLGFDVITPVNPFYRCFKKVSHVPILYLTSKPVSLRHLPNSSYLFISKEKLQKTYQ
KKD
NT seq 552 nt   +upstreamnt  +downstreamnt
atgaaaacttgtttcctttccatatggagagtggttgatccgatttatttctttttttca
aggctaagcttgattgacaacgatcaaaaaagcgtttttcgagtcaggctgacgaagtac
aaaggacatcatgtcgtgcttagcgacggaacgcatataagaaaaaatgatgtgctcgtt
aaaatccacctgcataacataaagctgatcagggagctgcaaagcattgagagcgcagtc
agaaagggaatcattatttatcagaaagtatatcaatcgatgccgcttcttcttgactat
atcaacaatcataaaaaaagcgagaaaatcaaaggaatcattgggattacaatgcttgac
aaaggtgtggaaaggctcggctttgatgtgatcaccccggtgaaccctttttacagatgc
tttaaaaaagtgtctcatgtgccgattttatatttgacttcaaagcctgtgagcttgcgg
catttaccgaattcatcctatttgtttatctcaaaagaaaagctgcagaaaacctatcaa
aaaaaagactga

DBGET integrated database retrieval system