KEGG   Bacillus subtilis subsp. subtilis 168: BSU13380
Entry
BSU13380          CDS       T00010                                 

Symbol
ykoS
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF6044 DUF6220
Other DBs
NCBI-GeneID: 939380
NCBI-ProteinID: NP_389221
Pasteur: BG13262
BSORF: BG13262
UniProt: O34830 A0A6M3Z9Z3
Position
1401772..1403466
AA seq 564 aa
MLRLMRQQKKETYYLWIALFLLLLYVSPLFILKEDAHIRVHDNLDSNIAWYKVLADSGEI
VGKVDAAIPQIINGLPRDAFGTEWSGIVWLHAFFSSMTAYAISQTVTRVVAFFGMYVLLK
KHIIPEPKAAFIRIGVSLAFALTPFWPSGMLSTLGYPLALWAFLNIRKGDISWREWLTLG
LLPLYSSFVLGFFFFLAGMACFWLYDAITKRRWNLMFLGSIAFMTSIYLFVEYRLVYSML
FEHAPMHRIEFISSRHDVWHSLRLSIKNFVYGHNHVMTVHTVVILPILMVVFAALLFKRN
RTKPENVYLFLCVLNYGLSLWYAFWFNKIWAVPKQKFAFLAEFNFARFHFLRPLVIYVSF
ALALYLIWRMGKGWKWLVYAAVAAQLMVLAPFNEEYTYGVHYNAPTFREFYASEQFKEIK
EYIGRPQDSYRVASIGLHPSIAQYNGFYTLDTYNNLYPLSYKYEFRKIIEKELEKNSRLK
QYFDEWGSRCYLFVDELGKRYDFKKNSKKTINNLQLNTDVFKKMGGRYIFSSVPIMNAEQ
NHLALVKTFDHKDSAWRIYLYETR
NT seq 1695 nt   +upstreamnt  +downstreamnt
atgttacgattgatgagacaacaaaaaaaagaaacatattatctctggatcgcattattt
cttcttttattgtatgtatccccgctttttattttaaaggaagatgcccatatccgggtc
cacgataatttagattccaacatcgcttggtacaaggttctggccgatagcggagaaatc
gtcggcaaggttgacgctgccattccgcaaatcattaacgggctgccccgggatgccttt
ggcaccgagtggagcggaattgtttggctccatgctttcttttcttccatgaccgcctat
gcaataagccagacggttacaagagttgtcgctttttttggaatgtatgtgctgctgaag
aaacatataatcccggaaccaaaagcggctttcatccgaattggcgtatcgcttgcattt
gccttaacaccgttctggccttcgggaatgctgagtacgcttgggtaccctttggcactg
tgggcttttttaaatatccgaaaaggggatatctcatggagagagtggctgacgctgggc
ttgctccctctatactcaagctttgttctaggcttcttctttttcctggcagggatggcg
tgtttttggctgtatgatgccattacaaaaagaagatggaatttgatgttcttaggcagt
attgcatttatgacgagtatctatcttttcgttgaatatcggcttgtctattcgatgctg
tttgagcacgcaccgatgcatcgtatcgaatttatctcatctaggcatgacgtttggcat
tctcttcgactatccataaaaaactttgtctatggccataatcatgtgatgaccgttcat
accgttgtcatccttccgatcctgatggtcgtatttgctgctctgctgttcaaacgaaat
cggacaaagccagaaaatgtttatctgtttttatgtgtgcttaattacgggttgtcatta
tggtatgcgttttggttcaacaaaatttgggctgttccaaagcagaaatttgctttttta
gcagaatttaattttgcccgttttcattttcttcggccgcttgttatatacgtgagcttt
gcgcttgctttatatctcatttggcggatggggaaaggatggaaatggcttgtgtacgcc
gcagtcgctgcacagctgatggtgttggcgccttttaatgaagaatatacgtatggtgtt
cattacaacgcgccgacattcagggagttttatgcatcagagcaattcaaagagattaag
gaatatatcggacgtccgcaagattcgtatagggtggcgagcatcggactgcatccgtct
atcgcccaatataacgggttttatacgttagatacgtataacaatctgtatccgctctca
tataaatatgaatttagaaaaatcatcgaaaaagagctggaaaaaaattctcggctgaaa
caatactttgatgaatggggcagccgctgctacctttttgtcgatgaactcggtaaacga
tatgatttcaaaaagaactcgaagaaaacgatcaacaaccttcaattaaatacagatgta
tttaaaaaaatgggtggacggtacattttttcttcagttccgatcatgaatgctgaacaa
aaccatctcgcgctcgtaaagacgtttgaccataaagattccgcctggcgcatttattta
tatgaaacaagataa

DBGET integrated database retrieval system