KEGG   Bacillus subtilis subsp. subtilis 168: BSU13390
Entry
BSU13390          CDS       T00010                                 

Gene name
ykoT
Definition
(RefSeq) glycosyltransferase YkoT
  KO
K20534  polyisoprenyl-phosphate glycosyltransferase [EC:2.4.-.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:bsu01005]
    BSU13390 (ykoT)
Enzymes [BR:bsu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.-  Glycosyltransferases
    2.4.-.-  
     BSU13390 (ykoT)
Lipopolysaccharide biosynthesis proteins [BR:bsu01005]
 O-antigen repeat unit
  BSU13390 (ykoT)
SSDB
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_3
Other DBs
NCBI-GeneID: 939378
NCBI-ProteinID: NP_389222
Pasteur: BG13263
BSORF: BG13263
UniProt: O34755 A0A6M4JHW5
Position
1403479..1404492
AA seq 337 aa
MKQSQPVLTIVVPCFNEEEVFQETSHQLTEVVDDLIEEKLIAEDSKILFVDDGSKDRTWA
LIAMESIRNKKVTGLKLACNVGHQKALLAGLHKAKNRSDCVISIDADLQDDISVIRDFML
KYHEGCEIVYGVRRSRKTDTFFKRTTALGFYRLMNKLGIKLIYNHADFRLMNKRSLEELE
RYPEANLFLRGIVPMIGFKSAEVLYDRKERFAGKTKYPLKKMLSFAFNGITSFSVAPIRF
FTLLGFVLFFLSAVAGIGAFIQKLLGHTNAGWASLIISIWFLGGLQLMGIGIIGEYIGTI
FSEVKRRPKYAIDIDLYNEQLSPLQRQEKERLEKKYS
NT seq 1014 nt   +upstreamnt  +downstreamnt
ttgaaacagtcacagccagtattaaccatcgtcgtcccgtgtttcaatgaagaggaagtg
tttcaagaaacaagccatcagctgacagaggttgtagatgatttaattgaagaaaaatta
attgctgaagacagtaaaattctgtttgtcgatgatggcagcaaagaccgcacttgggct
ttgattgctatggagagcataagaaacaagaaggttaccggcttaaaattagcctgcaat
gtcggccaccaaaaagcgcttttagccggattgcataaagcgaagaataggtcagactgc
gtcatttcgatcgatgctgatcttcaggacgacatctctgtgatccgggattttatgctg
aaatatcatgagggctgcgagatcgtttacggtgtacgccggagcagaaaaaccgatacc
tttttcaagcgcacgaccgcgttagggttttatcgtctcatgaataaacttgggattaaa
ttaatttataatcatgctgattttcgtttaatgaataaaaggtcccttgaagagcttgag
cgttatccggaagcgaatctgtttttaagaggtattgtccccatgatcggctttaaatcg
gccgaagttttgtatgaccgcaaggaacgctttgccggcaaaacgaaatatccgctgaaa
aagatgctatccttcgcttttaacgggattacttcattcagtgtcgcaccaattcgattc
tttacgcttttagggtttgttttgtttttcctcagcgctgtggcagggattggcgcgttt
attcaaaagctgctcggccatacgaatgcaggctgggcgtctcttatcatatccatttgg
tttttgggcgggctgcaattgatgggaattggaatcatcggagagtatattggaacgatt
ttttctgaagtgaaaagacggccgaaatacgcgattgatattgatttgtataatgaacag
ctgagcccgcttcagcgccaggaaaaagagcggttagaaaaaaagtacagttaa

DBGET integrated database retrieval system