KEGG   Bacillus subtilis subsp. subtilis 168: BSU13410
Entry
BSU13410          CDS       T00010                                 

Symbol
ykoV
Name
(RefSeq) DNA repair protein YkoV
  KO
K10979  DNA end-binding protein Ku
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    BSU13410 (ykoV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bsu03400]
    BSU13410 (ykoV)
DNA repair and recombination proteins [BR:bsu03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     BSU13410 (ykoV)
SSDB
Motif
Pfam: Ku DUF1631 DUF6058
Other DBs
NCBI-GeneID: 939375
NCBI-ProteinID: NP_389224
Pasteur: BG13265
BSORF: BG13265
UniProt: O34859 A0A6M3ZDH7
Position
complement(1406357..1407292)
AA seq 311 aa
MNRTPSLHTKEKKGFIDMHTMWKGSISFGLVNIPIKLYAATEDKDIKLRSLHKEDHAPIK
YEKVCTNCEKTLSPDEIVKGYEYVKGKYVVLTDEDLKSLKQEHEEKAVEIVDFVQLQEID
PIYFNRSYFVGPGDNGTKAYTLLREALRSTGKIGIANMTIRSKQQLAILRVYENCIVMES
IHYPDEVRSAAQVPGVPDQSNVNDKELQTAITLIDELTAKFEPEKYEDTYRQALLQRVND
KLENKETAVTPDKAPPREDVIDLVSALQASIDRTRRPNRETPAAAPAQAAEPKGAGDKKQ
KTTRKKASGTS
NT seq 936 nt   +upstreamnt  +downstreamnt
atgaatcgtactccttctcttcacactaaagaaaaaaaggggtttatcgatatgcataca
atgtggaagggatcgatcagcttcggattagtaaacatccccatcaagctatatgcggcc
acagaagataaagatattaaactgcgcagcctccataaagaggatcacgcaccaatcaaa
tacgagaaagtttgcacaaattgcgaaaaaactcttagtcctgatgaaattgtgaaggga
tatgaatatgtaaaaggaaaatatgtagtgctgacagacgaagatttaaaaagcttaaaa
caggagcatgaggagaaagcagttgagattgttgactttgttcagcttcaggaaattgat
ccgatttattttaaccgctcctactttgtcggccccggggataatgggacgaaggcctat
accctgctgcgtgaggcgctgcgctcaaccggaaagatcggtatcgccaatatgacaatc
aggtcaaagcagcagctggcgattctccgcgtttatgaaaattgtatcgtcatggagtct
atccattatcccgatgaggtcagaagcgccgctcaagtcccaggtgtacctgatcaatcg
aatgtaaacgataaggaactgcaaactgctatcacattaatagatgaactgactgctaag
tttgagcctgagaaatatgaagacacgtaccgacaggcgctgctgcaaagagtcaacgac
aagctagaaaataaagaaacggctgtcactcctgataaagcgccacctcgtgaagatgtc
attgacctggtaagcgctctgcaagccagcatcgacagaaccagaaggccgaaccgggag
acaccggctgccgcacctgcacaagccgctgaaccgaaaggagccggagataaaaaacaa
aaaacaactagaaaaaaagcctccggcacatcatag

DBGET integrated database retrieval system