KEGG   Bacillus subtilis subsp. subtilis 168: BSU13420
Entry
BSU13420          CDS       T00010                                 

Gene name
dgcW
Definition
(RefSeq) diguanylate cyclase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: EAL GGDEF MHYT PAS_9 DUF6334
Other DBs
NCBI-GeneID: 2914252
NCBI-ProteinID: YP_054577
Pasteur: BG13266
BSORF: BG13266
UniProt: O34311 A0A6M4JJ90
Position
complement(1407329..1409578)
AA seq 749 aa
MGFGIWSMHFVGMMAVHMEMPMEYEFMPLMAAIGASVSGSFVSLYFVSRHILTYYRLLTG
SVVLGASIASMHYIGMSAISRVMIIYEPILFTVSIIIAIAASFVSLKIFFDLAVKKHSEH
LIFYKGVSSIVMGIGISGMHYTGMLAATFHKDMAPPGSHMEVQTFHWSIFVTLIIFCIQT
LLLFSSHADRKFIKQSERIKDNEQRFQSLIVHNIDAIFILSLEGDIISSNHAGEEMISKF
GFSMHDWRNYTSLKVKRLFEQVKKDKQAMNSDSDLITEKGQFHLNITLIPVEVNQELDSI
YVICKDMTKQYKAEKEIHRMAHYDSLTDLPNRRHAISHLTKVLNREHSLHYNTVVFFLDL
NRFKVINDALGHNVGDQLLQFAAKRLSSVVPDNGFIARLGGDEFIIILTDANTGTGEADV
LARKIIQKFKKPFKIQDHTLVTSVSIGIAISPKDGTDGLELMKKADMAMYAAKERNKSKY
RYYSFSIGNKETVKLNQEMVLREAIENDRFVLHYQPQFSVKKQKMTGAEALIRLVTPDGQ
LRPPGEFIGVAEETGLIIDIGKWIIDEACKQARIWHDKGYDLSVAINISARQFQSKDLIP
LIKDTLNKYQLPPQLLEVEVTESMTMDNLNHSKKVLSSLTELGIRISIDDFGTGHSSLSY
LKDFPIHRLKIDKSFIDDIQTHPKSEQITGAIIAMGHQLSLQVIAEGVENAAQKQLLFEK
GCDHLQGFFFSRPIPPEQFEQFIIEQPSQ
NT seq 2250 nt   +upstreamnt  +downstreamnt
atgggattcggtatttggtcaatgcattttgtagggatgatggccgtccatatggaaatg
ccgatggaatatgaattcatgcctttaatggcagccattggcgcatctgtttcgggatca
tttgtgtcattatattttgtcagccggcacattcttacatattacagactgcttaccgga
tcagttgtgcttggcgcatctattgcttctatgcactatatcggaatgtctgccatttcc
cgggtaatgattatttacgaacctattttatttacagtttcaattatcattgcgattgca
gcctctttcgtctcgttaaaaatattctttgacttggccgtaaaaaaacattctgagcat
cttatattctataaaggcgtcagttcaattgtaatgggcattgggatttcgggcatgcac
tacacagggatgcttgcggcaactttccataaggacatggctccgcccggaagccatatg
gaggtgcaaacgtttcattggtcaatttttgttactttaattattttttgtatccaaacg
ttattgttattcagttcccatgcagatcgaaagtttattaaacagagcgaacgcataaag
gataacgaacagcgatttcagtctttaatcgtccacaatattgatgcaatttttatttta
tcattagaaggagacataatatcttccaatcacgctggtgaggaaatgatcagcaaattt
ggcttcagcatgcatgactggaggaattacacatcactgaaggttaagcgcctttttgag
caagttaaaaaagataaacaagcgatgaacagcgatagcgatcttatcactgaaaaaggc
cagtttcacttaaatattacgcttatacctgttgaggtcaatcaggaactagacagcatt
tatgtcatttgtaaagacatgacgaagcagtacaaagcagaaaaagaaatccatagaatg
gctcattatgattcgcttacagacttacctaacagaaggcatgccatctctcatctaaca
aaggtgctgaatcgcgagcattccttgcattataacactgttgtattctttcttgactta
aaccggtttaaagtgattaacgatgcattagggcataatgtcggtgatcaattgcttcag
tttgcagctaaacgcctgtcatctgtagtccctgataacggatttatcgcccgtcttggc
ggtgatgaatttattattatattaacagacgccaatacaggaacaggcgaagcagatgtt
ttagcaagaaaaattatccaaaaattcaaaaaacctttcaaaattcaagatcacaccctt
gtcacatctgtcagtatcgggattgcgatatctccaaaagacgggacggatggccttgaa
ttgatgaaaaaggctgatatggcgatgtatgcggctaaagaacgaaacaaaagcaaatac
agatactattctttttcaatcggcaacaaagaaaccgttaagcttaaccaagagatggta
ctcagagaagcaatcgaaaacgatagatttgtcttgcattatcagccgcaattcagtgtg
aaaaaacaaaaaatgacaggagcagaagcactgatacgccttgtgacaccagacgggcaa
ctgcgtccgcccggagaattcatcggtgttgcagaagaaacgggacttattattgatatc
ggaaagtggattatagatgaagcatgcaagcaggcaaggatttggcatgacaaaggctat
gatctttctgtcgccattaatatttccgccagacagtttcaatctaaagatctgattccc
ctcatcaaggatacgcttaataagtaccagcttcctccgcagcttcttgaagtggaggtg
acggaaagcatgacaatggacaatctcaatcactccaaaaaggttttgtcatccctaaca
gaattaggaatcagaatcagtattgacgatttcggtactggtcacagctctcttagctat
ttgaaggacttcccgattcacaggctgaagattgacaaatcatttattgacgatattcag
acccatcctaaatcagagcaaattaccggagctattattgccatggggcatcagctgtct
ttgcaggtgattgccgaaggtgtggaaaatgcagctcaaaagcagcttctttttgaaaaa
ggctgcgaccatttgcagggcttctttttcagcaggccaatacctccggaacaattcgaa
caattcattattgaacagccgtcgcaataa

DBGET integrated database retrieval system