KEGG   Bacillus subtilis subsp. subtilis 168: BSU13430
Entry
BSU13430          CDS       T00010                                 

Gene name
ykoX
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: SNARE_assoc DUF6203 Halogen_Hydrol
Other DBs
NCBI-GeneID: 939381
NCBI-ProteinID: NP_389226
Pasteur: BG13267
BSORF: BG13267
UniProt: O34908 A0A6M3ZFA2
Position
1409912..1410577
AA seq 221 aa
MIHKHETRELVAIEELVMSWIEAFKSLSYFGIFLALSIEFIPAEVVLPLAGYWVSKGDMT
LAGVVLAGSLGGVAGPLTLYWIGRYGGRPFLERFGKYLFIKPEALDKSDNFFKKHGGFVA
FSGRFLPGIRTLISIPCGIAKMNVWVFSLYTFIAMLPITFVYVYLGVKLGENWKAVGSIL
DQYMLPIGIAILALFLLYLLMKKRKKRTHSEQLSVFLKNKR
NT seq 666 nt   +upstreamnt  +downstreamnt
atgatacataaacatgaaacaagggagttggtggctatcgaagagctggttatgtcatgg
attgaagcatttaaaagcttatcttattttggaatatttctagcgctcagcattgagttt
attccggccgaagtcgtcttgccgcttgcgggctattgggtatctaaaggcgatatgaca
cttgctggcgttgttttggcaggatcgcttggaggagtggccggtccgcttacgctgtat
tggataggccggtacggaggaaggccgtttcttgaacgttttgggaagtatctctttatt
aaacctgaagcgcttgataagtcagataattttttcaaaaaacatgggggctttgtcgcc
ttcagcggccgtttcttgcctggtatcaggacattgatttccataccgtgcggaattgca
aaaatgaatgtttgggtgttttcgctttatacattcattgctatgcttccgattacattt
gtatatgtttatctcggtgtgaagctcggtgaaaattggaaggcagtcggctctattctt
gatcaatatatgcttccgatcgggatagcgattttggcgctgttcctgctctacttactg
atgaaaaagaggaagaaacgcacgcactccgaacaattatctgtatttttgaaaaataaa
cgttga

DBGET integrated database retrieval system