KEGG   Bacillus subtilis subsp. subtilis 168: BSU13440Help
Entry
BSU13440          CDS       T00010                                 

Gene name
ykoY
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TerC DUF3488 YuiB
Motif
Other DBs
NCBI-GeneID: 939368
NCBI-ProteinID: NP_389227
Pasteur: BG13268
BSORF: BG13268
UniProt: O34997
Position
1410654..1411628
Genome map
AA seq 324 aa AA seqDB search
MYSGNKVVISWIVSIGFVGMPEFMSSKTFALCRQRSFLHGPAGIRSDEEKENNFFGRVSF
MDAALLLEYGWVLLVLIGLEGILAADNALVMAVMVKHLPEEKRKKALFYGLAGAFVLRFG
SLFAISFLVNVWQVQAIGAIYLLYISASHLLKRYVFKKEDTHKETKQSGFWPTVLKVELA
DIAFAVDSILAAVALAVTLPGTSLPKIGGLDGGQFLVILAGGIIGLVIMRFAASMFVKLL
KERPSLETAAFVIVGWVGVKLALYTLAHRDIAVVSEHFIHSGTWKLIFWGVLAAIAVCGW
FMSGGKKQPEGAQNEQKNSTRERA
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgtattccggaaacaaagtcgtcatttcatggattgtatccatcggctttgttggcatg
cctgaattcatgtctagcaagacctttgccttatgtcggcaaaggtcttttttgcatggt
ccggccggcataagatcggatgaagagaaagaaaacaacttttttgggagggtatcattt
atggatgcagcattattattagagtatggttgggttcttctcgtcttgatcgggctggaa
gggattttagccgccgataacgcgctggttatggcggtaatggtaaaacatttgccggag
gaaaaaagaaaaaaagcgttattttatggattggcaggggcttttgttctgcgatttggc
tctttatttgcaatttctttcttggtcaacgtatggcaggttcaagcgattggcgcgatc
tatttgctgtatatctcagcaagccacttattgaaaagatatgtatttaagaaagaagac
acacataaagagacgaagcaaagcggtttttggccgactgttttaaaagttgaactggca
gatatcgcgtttgctgttgattccatcttagcagcagtagcgctggcggttacacttcct
gggacatcactcccgaagatcggcggacttgacggaggacaatttctcgtcattttggcc
ggcggtatcatcggactggtgatcatgcggtttgcggcttccatgtttgtgaagttatta
aaggaacgtccaagcctagaaacagcagcctttgtgattgtcggctgggtcggagtgaag
cttgctttatatacgcttgcccatcgcgacatagcggttgtttctgagcactttatccat
tctggaacatggaagctgatattctggggtgtcttagcagcaatcgcggtttgcggctgg
tttatgtcaggtgggaaaaaacagccggagggtgcacaaaacgaacaaaaaaacagcacc
cgtgaacgggcgtaa

DBGET integrated database retrieval system