KEGG   Bacillus subtilis subsp. subtilis 168: BSU13450Help
Entry
BSU13450          CDS       T00010                                 

Gene name
sigI
Definition
(RefSeq) RNA polymerase sigma factor SigI
  KO
K03093  RNA polymerase sigma factor
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:bsu03021]
    BSU13450 (sigI)
Transcription machinery [BR:bsu03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     BSU13450 (sigI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma70_r2 DUF4833 EPO_TPO CAMSAP_CC1 Colicin HTH_11 Histone_HNS Ago_PAZ TOBE_3 Snurportin1
Motif
Other DBs
NCBI-GeneID: 939363
NCBI-ProteinID: NP_389228
Pasteur: BG13269
BSORF: BG13269
UniProt: O31654
Position
1411892..1412647
Genome map
AA seq 251 aa AA seqDB search
MKPVLSLLFKLGKKKQTLEKAVESIQKGNKDLQNELIQQYKPFIAKTVSSVCKRYIDEKD
DEFSIGLIAFNEAIEKYSPEKGNSLLAFAELIIKRKVIDYIRKEARSAQNINIDLQEGDD
QESSQSLIEAELSIDEYRRQIEQEQRREEILYFQKQLKDYGLSFKELLENSPKHTDARQN
AIKVAMTLVEHEELAAILYTKKQLPVKQLEQLVSVSRKTIERNRKYIIAMCIIITGDYIY
LKDYLKGVLHS
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaccagtgcttagccttttgtttaaattgggaaaaaagaagcaaacacttgaaaaa
gctgttgagagtatacaaaaaggcaataaagatctgcaaaatgaattaatacagcaatat
aagccatttatcgcaaagacggtttcatccgtttgtaaacgatatatagatgaaaaagac
gatgagttcagtattggactgatcgcgtttaatgaagctatagaaaaatattcacctgaa
aaaggaaattctctgctcgcatttgctgagcttattataaaaagaaaagtcattgattac
attagaaaagaagccagaagcgcacaaaatataaatatcgatttacaggaaggagacgat
caggagtcatcacaaagcctgattgaagccgagctttccattgatgaataccgccgtcag
attgaacaggagcagaggcgggaggaaatcctctattttcaaaagcagctcaaggattat
ggtttatcgtttaaagaactgcttgaaaattctccaaaacacacggatgcaaggcaaaac
gccataaaggtggcaatgacgcttgttgaacatgaagaattggccgctatcctgtataca
aagaagcagcttccggtcaaacagcttgaacagcttgtctctgtaagccgaaaaacgatt
gagagaaacagaaaatatattattgcgatgtgtattatcattacgggtgattatatttat
ttaaaagattatcttaaaggggtgctgcactcatga

DBGET integrated database retrieval system