KEGG   Bacillus subtilis subsp. subtilis 168: BSU13460Help
Entry
BSU13460          CDS       T00010                                 

Gene name
rsgI
Definition
(RefSeq) anti-sigma-I factor RsgI
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RsgI_N
Motif
Other DBs
NCBI-GeneID: 939360
NCBI-ProteinID: NP_389229
Pasteur: BG13272
BSORF: BG13272
UniProt: O31655
Position
1412644..1413789
Genome map
AA seq 381 aa AA seqDB search
MRRGIIVEKNKKFVTLLTPDGQFLKAKNDRHSYEIGEEIMLPSETRMGRRASFFDFFKLR
PFKMGIFTMTAIMLFIFIVLPVFSNNKAYAYMTIDINPSVEMALNSDYEVIELTPLNDEG
QKVVNDIDDWEKTDFKKVIDDIITDCSEHGYVKKSKEILISTVYENTEDNTYKKAVKKQL
NDVTEKYKTTYRMESLESDMQTREKAKKEGVSTGSYIKSNEKNDNKDIKDDSSKPSGEED
QKSDENEDENTDQTDTQDSKQGDNEQLNDADSGDQKEEKADDQIDDSDKDKKIKESDENT
NTEKDGDHEQTPIQDPQDKGNENNGADKGQSQYHRDWNNGEQGKNRSSSRRDNASDRRNP
NGYSSDNHSAKNEDSPSAPGE
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgagaagagggattatagtagagaaaaataaaaaattcgtcacgttgctgacccctgac
ggacaatttttaaaagccaaaaatgatcgacacagctatgaaatcggagaagaaatcatg
cttccgagtgaaacacgcatgggcagaagggccagcttttttgatttttttaaactgcgc
cctttcaaaatggggatttttacgatgactgctattatgctctttatttttatagttctc
cccgttttttctaataataaggcctatgcgtatatgacaatcgatatcaatccaagcgtc
gaaatggcgttaaacagcgattatgaagtgattgaactgacgcctctaaacgatgaggga
cagaaagtcgtgaatgatatagatgattgggagaagactgattttaaaaaggtgattgac
gatattataaccgactgcagtgaacacgggtatgtaaaaaaatcgaaagaaatattgatt
tccactgtttatgaaaacacagaagacaatacatataaaaaggctgtgaaaaaacagctg
aatgatgtgactgaaaaatataaaacgacataccgcatggaatctctcgagtcagatatg
caaacgagggaaaaagcgaagaaagaaggcgtctcaacaggcagctacatcaaatcaaat
gaaaagaatgacaataaagatataaaagatgactccagcaaaccatccggggaagaggat
caaaagagtgatgaaaatgaggatgaaaacaccgatcaaactgacacccaggacagcaag
caaggagataatgaacagctgaatgatgcggattccggagaccagaaagaagagaaagcg
gatgaccagattgatgatagtgacaaagataaaaaaataaaggaatcagatgaaaacaca
aataccgaaaaagatggggaccatgagcaaaccccaatacaagatcctcaagataaagga
aatgaaaataacggcgctgacaagggccaaagccaatatcacagggactggaacaatggt
gaacaaggcaagaaccgttcttcgtccagaagggataacgcttcagaccgacgtaatcca
aacggctacagcagtgataatcattcagctaaaaatgaagattcgccgagtgcccccggc
gaataa

DBGET integrated database retrieval system