KEGG   Bacillus subtilis subsp. subtilis 168: BSU13470Help
Entry
BSU13470          CDS       T00010                                 

Gene name
sspD
Definition
(RefSeq) small acid-soluble spore protein D
  KO
K06421  small acid-soluble spore protein D (minor alpha/beta-type SASP)
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU13470 (sspD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SASP
Motif
Other DBs
NCBI-GeneID: 939362
NCBI-ProteinID: NP_389230
Pasteur: BG10788
BSORF: BG10788
UniProt: P04833
Position
complement(1413800..1413994)
Genome map
AA seq 64 aa AA seqDB search
MASRNKLVVPGVEQALDQFKLEVAQEFGVNLGSDTVARANGSVGGEMTKRLVQQAQSQLN
GTTK
NT seq 195 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcagaaataaactcgttgttccaggggtggagcaggcactagaccaatttaaa
ctcgaagtggctcaagaattcggtgtgaaccttggttctgatacagtcgcacgcgctaac
ggctctgtaggcggagaaatgacaaagcggctggtacagcaagcacaatcacaattaaat
ggcacaactaaataa

DBGET integrated database retrieval system