KEGG   Bacillus subtilis subsp. subtilis 168: BSU13480Help
Entry
BSU13480          CDS       T00010                                 

Gene name
ykrK
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1836 NPR1_like_C SAS4
Motif
Other DBs
NCBI-GeneID: 939367
NCBI-ProteinID: NP_389231
Pasteur: BG13273
BSORF: BG13273
UniProt: O31656
Position
complement(1414125..1414826)
Genome map
AA seq 233 aa AA seqDB search
MNIFKLSRTDMVRLLYSLKGQGEHSPLDILVQSANMSAEKAANHLEIPEFLTRYERKKQK
KEYGLSTNEIVELGNLCELTSLKSTAIQNWVKRDIKDLIGHPELGKKYSIEQAVILLIVR
DLKSIYDFEHIRAILKVAFNTISDRSDDVISPIAYYESCAYVLDAIHHQDTPSMKESNLQ
EIAEQETERLRHRFEELNDSQWLKIRQIIAITVLSILTFHIQATAHKMTADIL
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgaacatttttaaactctctcgaaccgatatggtgcggctgctctattccctaaaagga
caaggagaacatagcccgctcgacattctcgtccaatcagcgaacatgtcagcagaaaaa
gcagccaatcatctagaaattcctgaatttcttacaagatacgaacgaaaaaaacagaaa
aaagaatacggtctgtctacaaatgaaatcgtagagcttggcaacttatgcgagctgact
tcgttaaagtcaaccgcgattcaaaactgggtaaagcgtgatatcaaagatctgatcgga
caccctgagctgggcaaaaaatactcaattgaacaggcagttattcttttaattgtacgt
gatttaaaatccatttatgactttgaacacatacgggctattttaaaagtggcctttaac
acaatctcagacagatctgatgatgtcatcagcccgattgcttattatgaaagctgcgca
tatgtgcttgatgccatccatcaccaagatactccttctatgaaagaatcaaatctgcag
gagatcgccgaacaggagacagagcgtctccgtcaccgttttgaagaactgaatgacagc
caatggcttaaaatcagacagattatcgccattacagtcctctccattttgacattccat
attcaggcaaccgcacataaaatgacagcagacattctatag

DBGET integrated database retrieval system