KEGG   Bacillus subtilis subsp. subtilis 168: BSU13490
Entry
BSU13490          CDS       T00010                                 

Gene name
ykrL
Definition
(RefSeq) protease HtpX
  KO
K03799  heat shock protein HtpX [EC:3.4.24.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bsu01002]
    BSU13490 (ykrL)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     BSU13490 (ykrL)
Peptidases and inhibitors [BR:bsu01002]
 Metallo peptidases
  Family M48: Ste24 endopeptidase family
   BSU13490 (ykrL)
Motif
Pfam: Peptidase_M48 Peptidase_M56 SprT-like DUF5090 Peptidase_M1
Other DBs
NCBI-GeneID: 939359
NCBI-ProteinID: NP_389232
Pasteur: BG13274
BSORF: BG13274
UniProt: O31657 A0A6M4JHX7
Position
1414997..1415893
AA seq 298 aa
MAKRIFLFILTNILVLTTIGIVLSVLSSVTGVGTYFTADGGIDPMALLVFSLVVGFVGSF
TSLAISRWMAKTMMGVRVLNPKKHSLSYEEQQLVDRVHRLSRSAGLTKMPEVGIYRSPEV
NAFATGPSKRRSLVAVSSGLLEQMDDAAVEGVLAHEVAHITNGDMVTMTLLQGIVNTFVV
FLSRIAAWIASRFVKEDLAPIVHFIAMIIFQIVFSILGSLVVFAYSRHREFHADRGGADL
AGKDKMIHALRTLKSYSSRILEDDQTAVQTLKINGKKRSSLFSTHPDLDERIRRLEAK
NT seq 897 nt   +upstreamnt  +downstreamnt
atggcgaaaagaatttttctgtttattctaacgaatattttggtgcttacaacaatcggg
atcgttttgtctgttttaagctctgttacaggagtcgggacgtactttacagctgatggc
ggtatcgatccaatggcgcttcttgtgttcagtttagtcgttggatttgtcggttccttt
acgtctcttgcgatatccagatggatggcaaagacgatgatgggcgtcagagtgctgaat
ccgaaaaaacactcgctcagctatgaggaacagcaattggttgatcgtgttcacagatta
agccgctctgccggtttaacgaaaatgccggaagtcgggatttaccgttcacctgaagta
aacgcgtttgcgactggaccgtcaaaacgccgttcacttgtcgcagtatcgtcagggctg
ctggagcagatggatgacgcagcagttgaaggtgtgcttgcccacgaggtcgcgcatatc
acaaatggtgatatggtaacaatgacgcttttacaaggtatcgttaatacctttgtcgtc
tttttatcgcgtatcgccgcttggatagcaagccgttttgtcaaagaagatctagcgccg
atcgttcattttattgcaatgattatttttcagattgtcttttcgatacttggcagcctg
gttgtgtttgcgtattcacgccatcgtgaattccatgctgacaggggaggagcggatctt
gccggcaaggacaagatgattcatgcgctgcggacgcttaaaagctattcttcccggatt
ttggaagacgatcagacagctgtccaaacgttaaagattaatggcaagaagcgctcttca
cttttctctactcatcctgatttagatgagcgaatcagacggctggaagctaaataa

DBGET integrated database retrieval system