KEGG   Bacillus subtilis subsp. subtilis 168: BSU13500Help
Entry
BSU13500          CDS       T00010                                 

Gene name
ktrD
Definition
(RefSeq) ktr system potassium uptake protein D
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrkH
Motif
Other DBs
NCBI-GeneID: 939342
NCBI-ProteinID: NP_389233
Pasteur: BG13275
BSORF: BG13275
UniProt: O31658
Position
1416067..1417416
Genome map
AA seq 449 aa AA seqDB search
MRLKFGKLIQALSPAQLIALYYFLAVTVAVILLSLPAAHKPGADWTFIDALFTAVSSVSV
TGLTVVDTADTFSTIGIFILAFVLQFGGIGIMTLGTFIWLIMGKRIGLKERKLIMVDQNQ
SQFSGIVNLMKQVLFLILWIEFFGGLILGTYFLTYYDSYQEAYLHGFFASISATTNGGFD
ITGNSMIPFRHDYFVQFITMLLIIFGAIGFPVLVEVKDFLFSKHRRYPFTLFTKITTITF
GSLVLFGAIGIFALEANHAFAGKSWHDILFLSLFQSTATRSGGLATIDISQLSDSTLFFI
CALMFIGASPSSVGGGIRTTTFALNLLALFHFARGNKAVKVFKRELHPADLMKSLVVTMM
AILLVFGATLILTITEKHSLLELLFEVCSAFGTTGLSLGITADLSSVGKCVIMIVMFIGR
IGILTFLYLIGRKEIEANYHYPKERVIIG
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgagattaaagtttggaaaattgatacaggccttgtcaccggcccagctgatcgcatta
tattattttcttgcagttactgtggccgttatattgctgagtttgccggcggcccataaa
ccgggggcggattggacgtttattgatgcgctttttacagctgtcagttcagtcagtgta
acggggctgacagttgttgatacagctgatacattcagcacaatagggatttttatatta
gcatttgttctgcaatttggcggaatcggaattatgacgctcggaacgttcatttggctg
atcatgggaaaacgaatcgggctgaaagaacggaagctgattatggttgatcaaaaccaa
tcccagttttcaggaattgtcaatctgatgaagcaggtactgtttctgatcttgtggatt
gaattttttggcgggctgatactcggcacatatttcttaacctactatgactcctatcag
gaagcctatttacacggattttttgccagtatcagtgcaacgacaaacggcggatttgat
attaccggtaattcgatgattccatttcgccacgattactttgtgcagtttattacaatg
cttttaattatatttggagcgattggatttcccgtgcttgttgaagtaaaggatttcctg
ttttcaaagcatcggcgttatccatttacgctttttacaaagatcacgacgattacgttc
ggctcacttgtcttgtttggagccattggcatctttgccctggaagcaaaccatgcgttc
gcaggaaaatcatggcatgatattttgtttttgtccctgtttcaatcaacggcaacccga
agcggggggctggcaacaatcgatatcagccaattatcagattccacactcttttttatt
tgtgcgctgatgtttattggagcgtcgccaagctcagtcgggggaggcataaggacaacg
acttttgctttgaaccttcttgcgctgtttcattttgcccgcggcaataaggccgtaaag
gtattcaaacgggagcttcaccctgctgacttgatgaagtcgcttgttgtcacgatgatg
gcgatcctgctcgtttttggcgcgacactcattctgaccattacagaaaaacattccctg
ctggagcttttgtttgaagtgtgctcggcattcggtacaaccggcctatcgcttggaatt
acggcagatttgagcagtgttggaaaatgcgtcattatgattgtcatgtttatcgggcga
atcggcatcttgaccttcctgtatctgatcggaagaaaggaaattgaagcgaattatcac
tatccgaaggaaagagtgattatcggatag

DBGET integrated database retrieval system