KEGG   Bacillus subtilis subsp. subtilis 168: BSU13509
Entry
BSU13509          CDS       T00010                                 

Gene name
ykzP
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 8303057
NCBI-ProteinID: YP_003097718
UniProt: A0A6M4JHG0
Position
1417561..1417716
AA seq 51 aa
MKRKAEVNEAIKNNNTPTESMDPNSYKTQYHDDPNFRGANRNSKQGQQGGM
NT seq 156 nt   +upstreamnt  +downstreamnt
atgaagcgtaaagctgaagtgaatgaagccattaaaaataacaatacacctaccgagagc
atggaccccaattcatataagacacaatatcatgacgaccccaattttagaggggcaaac
cgcaattccaaacagggccagcagggaggcatgtaa

DBGET integrated database retrieval system