KEGG   Bacillus subtilis subsp. subtilis 168: BSU13510Help
Entry
BSU13510          CDS       T00010                                 

Gene name
ykzE
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 939354
NCBI-ProteinID: NP_389234
Pasteur: BG13333
BSORF: BG13333
UniProt: O31659
Position
1417719..1417895
Genome map
AA seq 58 aa AA seqDB search
MKKNRHSRDMQNHKKPMNKKVLEEEFSSELGDYNAGKIIETLEVTKPEKKKEKNKKQQ
NT seq 177 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaaaaaccgtcatagcagagacatgcaaaatcataaaaagcctatgaataaaaag
gtgctggaggaagaattctcaagtgaactcggggattacaatgccggaaagatcatcgaa
acgctggaagtcaccaagcctgaaaagaaaaaagaaaaaaacaaaaaacaacaataa

DBGET integrated database retrieval system