KEGG   Bacillus subtilis subsp. subtilis 168: BSU13520Help
Entry
BSU13520          CDS       T00010                                 

Gene name
ykrP
Definition
(RefSeq) membrane-bound acyltransferase YkrP
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl_transf_3
Motif
Other DBs
NCBI-GeneID: 939356
NCBI-ProteinID: NP_389235
Pasteur: BG13276
BSORF: BG13276
UniProt: O31660
Position
complement(1417938..1418960)
Genome map
AA seq 340 aa AA seqDB search
MSKSRDSYFDNAKFLLIFLVVFGHILRSFINDNHFMLYLYKFIYTFHMPAFILVSGYFAK
GFKRAGYVKKLAVKLIIPYLIFQIIYSVFYYIMQDESMANVNPIDPQWSLWFLVSLFFWN
LLLYPFSKLSKQWALFVSCGIAVLIGYLDFVSSTLSLSRTFVFLPMFLVGFYLNKHHFDL
LRSKRGKQIALGVLAAVFVICWGIDFDYSFLFGSKPYSSFGDVTLVSGLSRIGWYVLAFG
ATFSFLALVPQKRYFFTKWGTRTFYVYLLHGFIIKTLRQVGLEDWLTDYQSLVILLLLTA
ALTSVLSSNFVKTVAQPFIELRMTSLLQFVRGTGKNAYLK
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaatcgcgggacagttatttcgataacgcaaaatttttattgatattccttgtt
gtattcggtcatatccttcgttcctttattaatgataatcattttatgctctacctctac
aagttcatttacacattccatatgcctgcatttattcttgtatccggttatttcgcgaaa
ggctttaaacgggcgggatatgtaaaaaagctggcggtcaagctgattattccgtatttg
attttccaaattatttattccgtcttttattacattatgcaagatgaaagcatggcaaat
gtgaacccgattgatccgcaatggtcgttatggtttcttgtaagcttattcttttggaac
ctgctcctatatcctttttcaaagctttcaaagcagtgggcgctgtttgtcagctgcgga
atcgccgtgctgatcggttatctggactttgtcagcagcacgctgagcttgtcacggaca
ttcgtattcttaccgatgttccttgtcggtttttatttaaataaacatcattttgattta
ttgagatcaaaacgcggcaaacaaattgcgctcggagtgcttgccgcagtattcgtcatc
tgctggggcatcgattttgactattcttttctgtttggttcaaaaccgtattcttcattt
ggagacgttaccctggtaagcggactatcccgaatcggctggtatgtactcgcctttggg
gcaaccttcagctttttagcgctcgttccgcaaaaacggtatttctttaccaaatgggga
acccggacattttacgtgtatctgcttcacgggtttattattaagacattacggcaggtc
gggcttgaggattggcttactgactatcaaagcttagtgatcctcttgcttttaacagca
gccctgacatcagtcctctccagcaactttgttaagacagtcgctcagccattcattgag
ctgaggatgacaagcttattgcaatttgtcagaggaacgggcaaaaatgcttatttaaaa
tag

DBGET integrated database retrieval system