KEGG   Bacillus subtilis subsp. subtilis 168: BSU13540Help
Entry
BSU13540          CDS       T00010                                 

Gene name
ogt
Definition
(RefSeq) methylated-dna--protein-cysteine methyltransferase
  KO
K00567  methylated-DNA-[protein]-cysteine S-methyltransferase [EC:2.1.1.63]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bsu03400]
    BSU13540 (ogt)
Enzymes [BR:bsu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.63  methylated-DNA---[protein]-cysteine S-methyltransferase
     BSU13540 (ogt)
DNA repair and recombination proteins [BR:bsu03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   Direct repair
    BSU13540 (ogt)
 Prokaryotic Type
    BSU13540 (ogt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_binding_1 Methyltransf_1N
Motif
Other DBs
NCBI-GeneID: 939332
NCBI-ProteinID: NP_389237
Pasteur: BG10848
BSORF: BG10848
UniProt: P11742
Position
1421426..1421923
Genome map
AA seq 165 aa AA seqDB search
MNYYTTAETPLGELIIAEEEDRITRLFLSQEDWVDWKETVQNTEHKETPNLAEAKQQLQE
YFAGERKTFSLPLSQKGTPFQQKVWQALERIPYGESRSYADIAAAVGSPKAVRAVGQANK
RNDLPIFVPCHRVIGKNSALTGYAGSKTEIKAFLLNIERISYKEK
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgaactactatacgacagccgaaacgccgctcggtgaacttatcattgccgaagaggag
gaccggatcactcgtctatttctcagtcaggaagattgggtggattggaaagaaacggtt
cagaatactgagcataaggaaacacctaatcttgcagaagcgaaacaacagcttcaagaa
tatttcgcaggcgaaaggaagacattctccctgccgctcagccaaaagggcactcctttt
cagcaaaaagtgtggcaagcgctggagaggattccatatggcgaatcccgaagctatgcg
gatattgccgctgctgtcggcagtccgaaagcggtgcgcgctgtcgggcaggctaataaa
cgtaacgacctgccgatttttgtcccgtgccacagagtgatcggcaaaaacagtgcgtta
acaggatacgccggaagcaaaacggagatcaaagcatttttgctaaacatcgagcgaatc
tcctataaagaaaaataa

DBGET integrated database retrieval system