KEGG   Bacillus subtilis subsp. subtilis 168: BSU13550Help
Entry
BSU13550          CDS       T00010                                 

Gene name
mtnA
Definition
(RefSeq) methylthioribose-1-phosphate isomerase
  KO
K08963  methylthioribose-1-phosphate isomerase [EC:5.3.1.23]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00270  Cysteine and methionine metabolism
bsu01100  Metabolic pathways
Module
bsu_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BSU13550 (mtnA)
Enzymes [BR:bsu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.23  S-methyl-5-thioribose-1-phosphate isomerase
     BSU13550 (mtnA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IF-2B
Motif
Other DBs
NCBI-GeneID: 939341
NCBI-ProteinID: NP_389238
Pasteur: BG13278
BSORF: BG13278
UniProt: O31662
Structure
PDB: 

Position
complement(1422172..1423233)
Genome map
AA seq 353 aa AA seqDB search
MTHSFAVPRSVEWKETAITILNQQKLPDETEYLELTTKEDVFDAIVTLKVRGAPAIGITA
AFGLALAAKDIETDNVTEFRRRLEDIKQYLNSSRPTAINLSWALERLSHSVENAISVNEA
KTNLVHEAIQIQVEDEETCRLIGQNALQLFKKGDRIMTICNAGSIATSRYGTALAPFYLA
KQKDLGLHIYACETRPVLQGSRLTAWELMQGGIDVTLITDSMAAHTMKEKQISAVIVGAD
RIAKNGDTANKIGTYGLAILANAFDIPFFVAAPLSTFDTKVKCGADIPIEERDPEEVRQI
SGVRTAPSNVPVFNPAFDITPHDLISGIITEKGIMTGNYEEEIEQLFKGEKVH
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgacccattcatttgctgttccacgttctgttgaatggaaagaaacagctattaccatt
ttaaatcagcaaaagcttcctgatgagacggaatatttggagctgacgacgaaagaggat
gtatttgatgcgattgtcacgctcaaagtaaggggcgctccggcgatcggcattacagct
gccttcggactggcgcttgctgccaaagacattgaaacagacaatgtcacggaattccgc
cgcagactggaagacatcaaacaatatttaaacagctcacggcctaccgccattaatttg
tcatgggcgcttgagagactgagtcattcggtcgaaaacgcgatttccgtaaatgaagca
aaaacaaaccttgtccatgaagccattcagattcaggtcgaggatgaggaaacgtgccgg
ttgatcggccaaaacgccctgcagcttttcaaaaaaggcgacaggatcatgacgatctgc
aatgccggctcaatcgcgacaagccgctatggaacggcgctagctccgttttacttggcc
aaacaaaaagatttgggattacacatttatgcctgtgaaacaaggcctgtcctgcaaggt
tcacgccttactgcttgggagctgatgcaggggggcattgatgtcactctgatcacagac
agcatggccgcccatacgatgaaggaaaaacaaatttccgctgttatcgtcggagccgac
cgaattgcaaagaacggtgatacggcaaataaaatcggcacatacggtcttgctatttta
gcaaacgcctttgatattccgttttttgtcgccgcacctttatctacatttgatacaaag
gtcaaatgcggcgctgatatcccgatagaggaacgagatcccgaggaagtcaggcagatt
tccggagttcggaccgctccatccaatgtgcctgtctttaatcccgctttcgacattaca
cctcatgatctcatttcaggaatcatcacagaaaaagggattatgaccggaaactatgaa
gaagagattgaacagctgtttaaaggagaaaaggtgcattaa

DBGET integrated database retrieval system