KEGG   Bacillus subtilis subsp. subtilis 168: BSU13560Help
Entry
BSU13560          CDS       T00010                                 

Gene name
mtnK
Definition
(RefSeq) methylthioribose kinase
  KO
K00899  5-methylthioribose kinase [EC:2.7.1.100]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00270  Cysteine and methionine metabolism
bsu01100  Metabolic pathways
Module
bsu_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BSU13560 (mtnK)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.100  S-methyl-5-thioribose kinase
     BSU13560 (mtnK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: APH APH_6_hur Choline_kinase EcKinase DUF2252
Motif
Other DBs
NCBI-GeneID: 939336
NCBI-ProteinID: NP_389239
Pasteur: BG13279
BSORF: BG13279
UniProt: O31663
Structure
PDB: 

Position
complement(1423241..1424440)
Genome map
AA seq 399 aa AA seqDB search
MMMGVTKTPLYETLNESSAVALAVKLGLFPSKSTLTCQEIGDGNLNYVFHIYDQEHDRAL
IIKQAVPYAKVVGESWPLTIDRARIESSALIRQGEHVPHLVPRVFYSDTEMAVTVMEDLS
HLKIARKGLIEGENYPHLSQHIGEFLGKTLFYSSDYALEPKVKKQLVKQFTNPELCDITE
RLVFTDPFFDHDTNDFEEELRPFVEKLWNNDSVKIEAAKLKKSFLTSAETLIHGDLHTGS
IFASEHETKVIDPEFAFYGPIGFDVGQFIANLFLNALSRDGADREPLYEHVNQVWETFEE
TFSEAWQKDSLDVYANIDGYLTDTLSHIFEEAIGFAGCELIRRTIGLAHVADLDTIVPFD
KRIGRKRLALETGTAFIEKRSEFKTITDVIELFKLLVKE
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgatgatgggagtcacaaaaacacctttatacgaaacgttaaatgaaagctccgctgtg
gcgttggcggtgaagcttggcctatttccaagcaaaagcacgctgacatgccaggagatc
ggagacggcaacttaaattacgtttttcatatttatgatcaagaacatgacagagcattg
atcattaaacaggcggttccgtatgcaaaagtggtgggagaaagctggccgctgacaatc
gaccgtgcaagaatcgaaagcagcgctctcatccgtcagggcgagcatgtgcctcacctg
gttccaagagtgttttattctgatacggaaatggcggttaccgtcatggaggatctctct
cacctcaagatcgcaagaaaaggactcattgagggtgaaaactatcctcatctgtcgcag
cacatcggtgaatttttaggaaaaacacttttctactcatcagattacgcgcttgaacct
aaggtgaaaaaacagcttgttaaacagtttacaaatccagagctatgcgacattacggaa
agacttgtttttacagatcctttcttcgaccatgacacaaatgattttgaagaagagctt
cgtccttttgtcgaaaagctttggaataatgacagcgttaaaatcgaagccgctaagctg
aaaaagtcatttttaacgtctgcagaaacgttgattcatggtgatttgcatacaggaagc
attttcgcaagtgagcacgaaacaaaggtgattgatcctgagtttgctttttacggaccg
atcggctttgatgtagggcaatttatcgccaacttatttttgaacgcactcagccgtgac
ggggctgacagagagccgttatatgaacatgtcaaccaggtctgggaaacgtttgaagag
acgtttagtgaagcctggcagaaggacagtctggatgtttacgccaacatcgacggttac
ctcactgatacgctcagccatatttttgaagaagcaatcggatttgcgggctgtgagctg
atacgacgcacgatcggccttgcccatgtagctgacctggatacgatcgtgccgtttgat
aaacgaatcggcagaaaacgcttggcgctcgaaaccggcacagcctttatcgaaaaacgt
tcggaattcaaaacgataacagatgttattgaattatttaagttacttgtaaaggaatga

DBGET integrated database retrieval system