KEGG   Bacillus subtilis subsp. subtilis 168: BSU13570Help
Entry
BSU13570          CDS       T00010                                 

Gene name
mtnU
Definition
(RefSeq) hydrolase
  KO
K13566  omega-amidase [EC:3.5.1.3]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00250  Alanine, aspartate and glutamate metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BSU13570 (mtnU)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.3  omega-amidase
     BSU13570 (mtnU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase Lipase_GDSL_2
Motif
Other DBs
NCBI-GeneID: 939328
NCBI-ProteinID: NP_389240
Pasteur: BG13280
BSORF: BG13280
UniProt: O31664
Position
complement(1424767..1425546)
Genome map
AA seq 259 aa AA seqDB search
MKWTISCLQFDISYGKPSENIKKAEFFIEKESKHADVLVLPELWTTGYDLANLDELADED
GRSAQSWLKKTAKKHGVHIVAGSVAVRKNSDVYNTMYIADKEGQIIKEYRKAHLFQLMDE
HLYLSAGSEDGYFELDGVKSSGLICYDIRFPEWIRKHTTKGANVLFISAEWPLPRLDHWK
SLLIARAIENQCFVAACNCTGSNPDNEFAGHSLIIDPWGRVLAEGGREEGIVRAEIDLQE
SAEVRESIPVFDDIRKDLY
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaaatggacgatatcttgtcttcaatttgatatttcatacggaaaaccttcggaaaat
ataaaaaaggctgaatttttcatcgaaaaagaaagcaaacatgctgatgttcttgttctg
cctgaattatggacgaccggatatgatctggccaatcttgatgaactcgctgacgaagac
ggccgctccgctcagagctggctgaagaaaacggcaaaaaaacatggtgttcatattgtc
gccggatcggtcgctgtcaggaagaattctgatgtttataatacaatgtacatcgcggat
aaggaagggcaaatcattaaagagtacagaaaagcccatctttttcagctgatggatgag
catctgtatttatcagccggttccgaagacggatactttgagcttgacggcgtcaaaagc
tctggattgatctgttacgatatccgttttccggaatggatcagaaaacatacgacaaaa
ggcgccaacgtgctgtttatttctgcggaatggcctcttccccgccttgatcattggaaa
agcctgcttattgcgcgggccattgaaaaccaatgctttgtcgcagcctgcaattgtacc
ggttcaaatccggataatgaatttgcaggacatagcctgattattgatccatggggacgt
gtacttgctgaaggcggccgggaagaaggcatagtccgagcggaaatcgaccttcaagaa
agcgcagaagttcgggagagcattcctgttttcgatgatatcagaaaagatttatattaa

DBGET integrated database retrieval system