KEGG   Bacillus subtilis subsp. subtilis 168: BSU13590Help
Entry
BSU13590          CDS       T00010                                 

Gene name
mtnW
Definition
(RefSeq) 2,3-diketo-5-methylthiopentyl-1-phosphate enolase
  KO
K08965  2,3-diketo-5-methylthiopentyl-1-phosphate enolase [EC:5.3.2.5]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00270  Cysteine and methionine metabolism
bsu01100  Metabolic pathways
Module
bsu_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BSU13590 (mtnW)
Enzymes [BR:bsu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.2  Interconverting keto- and enol-groups
    5.3.2.5  2,3-diketo-5-methylthiopentyl-1-phosphate enolase
     BSU13590 (mtnW)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N ZNRF_3_ecto
Motif
Other DBs
NCBI-GeneID: 939339
NCBI-ProteinID: NP_389242
Pasteur: BG13282
BSORF: BG13282
UniProt: O31666
Structure
PDB: 

Position
1427034..1428278
Genome map
AA seq 414 aa AA seqDB search
MDENERSSGMSELLATYLLTEPGADTEKKAEQIATGLTVGSWTDLPLVKQEQMQKHKGRV
IKVEEREGTAASEKQAVITIAYPEINFSQDIPALLTTVFGKLSLDGKIKLIDLHFSEAFK
RALPGPKFGVYGIRKLLGEFERPLLMSIFKGVIGRDLSDIKEQLRQQALGGVDLIKDDEI
FFETGLAPFETRIAEGKQILKETYEQTGHKTLYAVNLTGRTADLKDKARRAAELGADALL
FNVFAYGLDVMQGLAEDPEIPVPIMAHPAVSGAFTSSPFYGFSHALLLGKLNRYCGADFS
LFPSPYGSVALPRADALAIHEECVREDAFNQTFAVPSAGIHPGMVPLLMRDFGIDHIINA
GGGVHGHPNGAQGGGRAFRAIIDAVLEAQPIDEKAEQCKDLKLALDKWGKAEAV
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atggatgaaaatgaaaggagctctggcatgagtgagttattagcgacatatctcctgacc
gaaccgggagccgatacagagaagaaagcagaacaaatcgcaacaggattgacagtaggc
tcctggactgatctgccccttgtaaaacaggagcaaatgcaaaagcacaaggggcgggtg
ataaaagttgaggagagagagggaactgctgcatcagaaaaacaagcggtcatcacaatt
gcctatcctgaaatcaatttctctcaggatattccggctttgctgacaacagtgtttggc
aagctgtccctggacggaaaaatcaaattaatcgatcttcacttctctgaagcatttaag
cgtgcactgccgggaccgaagtttggcgtatacggcatccggaagctgctgggagagttt
gagagaccgctgttaatgagcatatttaaaggcgtaatcggaagggacctgagtgatatt
aaagaacagctccggcagcaggcgcttggcggagttgacttgattaaagacgatgaaatt
ttctttgagactggtctagcgccttttgaaacaagaattgcagaaggaaagcaaatattg
aaagaaacgtatgaacaaaccggacataaaacgctgtatgcggtgaatttgaccggacgt
acggctgatctgaaagacaaagcgagacgcgccgccgaattgggagcggatgcgcttttg
tttaatgtcttcgcttacggcttggacgttatgcaaggccttgcagaagatcctgaaatc
ccagttccgattatggcgcatccagcagtgagcggagcgtttacgtcttctccgttttac
ggtttttctcacgctcttttactcggaaaattaaaccgatattgcggtgctgacttcagc
ctctttccgtctccatatggttcggttgcgcttccaagagcagatgcactggcgattcat
gaagaatgtgtgagagaggatgcttttaaccaaacatttgctgttccgtcagcaggcatt
catcccggcatggttccgctattaatgcgtgatttcggcatagaccacattattaacgcc
ggaggaggcgtacatggacatccgaacggtgcccaaggcggggggcgagcgttcagagct
attattgatgcggtcctagaggcccagccgattgatgaaaaagccgaacaatgcaaggat
cttaagcttgcgctagataaatggggaaaggctgaagccgtatga

DBGET integrated database retrieval system