KEGG   Bacillus subtilis subsp. subtilis 168: BSU13600Help
Entry
BSU13600          CDS       T00010                                 

Gene name
mtnX
Definition
(RefSeq) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase
  KO
K08966  2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase [EC:3.1.3.87]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00270  Cysteine and methionine metabolism
bsu01100  Metabolic pathways
Module
bsu_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BSU13600 (mtnX)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.87  2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase
     BSU13600 (mtnX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD Hydrolase UMPH-1 HAD_2 Hydrolase_like
Motif
Other DBs
NCBI-GeneID: 939331
NCBI-ProteinID: NP_389243
Pasteur: BG13283
BSORF: BG13283
UniProt: O31667
Structure
PDB: 

Position
1428275..1428982
Genome map
AA seq 235 aa AA seqDB search
MTTRKPFIICDFDGTITMNDNIINIMKTFAPPEWMALKDGVLSKTLSIKEGVGRMFGLLP
SSLKEEITSFVLEDAKIREGFREFVAFINEHEIPFYVISGGMDFFVYPLLEGIVEKDRIY
CNHASFDNDYIHIDWPHSCKGTCSNQCGCCKPSVIHELSEPNQYIIMIGDSVTDVEAAKL
SDLCFARDYLLNECREQNLNHLPYQDFYEIRKEIENVKEVQEWLQNKNAGESSLK
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgacgactcgaaaaccttttattatttgtgattttgacggaacaatcacgatgaacgac
aacattataaatatcatgaaaacatttgctcccccagagtggatggcattaaaagacggc
gtactttccaaaacgctgtcaatcaaggaaggtgtcgggcggatgttcggccttctgccc
agcagtttaaaagaagagattacaagttttgtattggaagatgcaaaaatcagggaaggc
tttcgggaatttgtagcatttatcaatgagcacgagattccgttttatgtcataagcggt
ggaatggacttttttgtatatcctttgcttgaaggcattgtggagaaagaccgcatttat
tgcaaccatgcttcatttgacaatgactatatccatattgactggcctcattcctgcaag
ggcacatgcagcaatcaatgcgggtgctgtaagccgtcggtcatccatgaactttctgaa
ccgaaccaatatatcatcatgatcggtgattcggttacagatgtggaggcagcaaagctg
tctgacctatgctttgcaagggattatttattaaacgaatgccgggagcaaaacctcaat
catcttccgtatcaagatttttatgagatcagaaaggaaattgagaatgtaaaggaggta
caggaatggctgcaaaacaagaacgctggcgagagctcgctgaagtaa

DBGET integrated database retrieval system