KEGG   Bacillus subtilis subsp. subtilis 168: BSU13610Help
Entry
BSU13610          CDS       T00010                                 

Gene name
mtnB
Definition
(RefSeq) methylthioribulose-1-phosphate dehydratase
  KO
K08964  methylthioribulose-1-phosphate dehydratase [EC:4.2.1.109]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00270  Cysteine and methionine metabolism
bsu01100  Metabolic pathways
Module
bsu_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BSU13610 (mtnB)
Enzymes [BR:bsu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.109  methylthioribulose 1-phosphate dehydratase
     BSU13610 (mtnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-GeneID: 939320
NCBI-ProteinID: NP_389244
Pasteur: BG13284
BSORF: BG13284
UniProt: O31668
Position
1428940..1429569
Genome map
AA seq 209 aa AA seqDB search
MAAKQERWRELAEVKRELAERDWFPATSGNLSIKVTDEPLTFLVTASGKDKRKETVEDFL
LVDQNGEPAESGHSLKPSAETLLHTHLYNKTNAGCCLHVHTVNNNVISELYGDQKKITFK
GQEIIKALGLWEENAEVTVPIIENPAHIPTLAALFAEEISEDSGAVLIRNHGITAWGKTA
FEAKRVLEAYEFLFSYHLKLKTLEHQLVK
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atggctgcaaaacaagaacgctggcgagagctcgctgaagtaaaacgggaattggcagag
agagattggtttccggcgactagcggcaatctgtcaattaaggttacagatgagccttta
acatttctcgtcactgcaagcggaaaagataaacgcaaagagacggttgaagattttctg
ctggtcgatcaaaacggagagcctgctgaaagcgggcattctctgaaaccgtcagcagaa
acgcttttgcatacacatttgtacaataaaaccaatgccggatgctgcctgcatgtccat
acggtaaacaataatgtgatttcagagttatacggagaccaaaagaaaatcacattcaaa
ggccaggaaattataaaagcactcggcttgtgggaagagaacgcagaagtgaccgttccg
attatagaaaatccggcacatatcccgacgctagcggcactgtttgcggaagagatttca
gaagattcaggagctgttctgatccgaaatcatggtattacggcttgggggaaaacagca
tttgaggcaaaaagagtgcttgaagcgtatgaatttttgttcagctaccatttgaaattg
aaaacactcgagcatcagctggttaaataa

DBGET integrated database retrieval system