KEGG   Bacillus subtilis subsp. subtilis 168: BSU13630
Entry
BSU13630          CDS       T00010                                 

Gene name
ykvA
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF1232
Other DBs
NCBI-GeneID: 939314
NCBI-ProteinID: NP_389246
Pasteur: BG13308
BSORF: BG13308
UniProt: O31670 A0A6M3ZAM3
Position
complement(1430161..1430481)
AA seq 106 aa
MKKKKAIMLGAAGGKAILKRKNRKKCIQHITTFFQMLRDWRNGDYPRSQVKTLLLLTAAI
LYIVMPLDIIPDVILGLGFIDDAAVLGLIWTLIKKELSQYEKWRLQ
NT seq 321 nt   +upstreamnt  +downstreamnt
atgaagaaaaagaaagcaataatgctcggagcggcaggcggaaaagcgattttaaagagg
aaaaaccgaaaaaaatgtatccagcacatcactactttttttcagatgcttcgcgattgg
cgaaatggcgactaccctcgttcacaggttaaaacacttttgctgttaactgccgcaatc
ctgtatatcgtcatgccgctcgatatcattccagacgtaatcctcggtcttggattcatt
gacgatgcagctgttttaggtttgatttggacactgattaaaaaagaactgtcacaatat
gaaaagtggcgtttgcaataa

DBGET integrated database retrieval system