KEGG   Bacillus subtilis subsp. subtilis 168: BSU13640Help
Entry
BSU13640          CDS       T00010                                 

Gene name
spo0E
Definition
(RefSeq) aspartyl-phosphate phosphatase Spo0E
  KO
K06376  stage 0 sporulation regulatory protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU13640 (spo0E)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SpoOE-like
Motif
Other DBs
NCBI-GeneID: 939315
NCBI-ProteinID: NP_389247
Pasteur: BG10769
BSORF: BG10769
UniProt: P05043
Position
1430684..1430941
Genome map
AA seq 85 aa AA seqDB search
MGGSSEQERLLVSIDEKRKLMIDAARKQGFTGHDTIRHSQELDCLINEYHQLMQENEHSQ
GIQGLVKKLGLWPRRDVMPAYDANK
NT seq 258 nt NT seq  +upstreamnt  +downstreamnt
atgggcggttcttctgaacaagaaagattgttggtgtctattgatgaaaaaagaaagtta
atgatagatgccgctagaaagcagggatttacagggcatgacacgatcaggcacagtcag
gagctggattgtttaataaatgaatatcatcagcttatgcaagaaaacgaacattcccaa
gggattcaaggccttgtaaagaaattaggcttgtggccccgcagagatgttatgccagca
tatgatgcaaataaatag

DBGET integrated database retrieval system