KEGG   Bacillus subtilis subsp. subtilis 168: BSU13650Help
Entry
BSU13650          CDS       T00010                                 

Gene name
eag
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_9_N Baculo_F
Motif
Other DBs
NCBI-GeneID: 939325
NCBI-ProteinID: NP_389248
Pasteur: BG10770
BSORF: BG10770
UniProt: P06630
Position
1431027..1431458
Genome map
AA seq 143 aa AA seqDB search
MKELAILITEMVNQFHDAFISLCGIFGIHLTDKEMHFWVIGIFGIFFFGVTHAVFTWLSK
WSMTALSFIYTVTVIIVIVFAIEIQQKVTGRGNMEFLDATEGIKGFLVFFMFFLLLKMLL
RFIKILFSGRPASKSNGNARSRR
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaactggcgattctcattaccgaaatggtcaatcaatttcatgatgcttttatt
tccttatgcggaatatttggcattcatttaactgacaaagaaatgcatttttgggtgatc
ggcatttttggcatattctttttcggcgtcactcacgctgtgtttacatggctttctaaa
tggagtatgacagccttgtcctttatctataccgttacagtcatcattgtcatcgtattt
gcgattgagattcagcaaaaggtgacggggagagggaatatggagtttttagatgccacg
gaaggtataaagggttttttagtattttttatgttttttttgcttttgaaaatgctgttg
cgtttcatcaaaatccttttttctggaagaccagcaagcaaatcgaatggcaatgcccga
tcacgaagataa

DBGET integrated database retrieval system