KEGG   Bacillus subtilis subsp. subtilis 168: BSU13660Help
Entry
BSU13660          CDS       T00010                                 

Gene name
kinD
Definition
(RefSeq) sporulation kinase D
  KO
K13532  two-component system, sporulation sensor kinase D [EC:2.7.13.3]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
Module
bsu_M00485  KinABCDE-Spo0FA (sporulation control) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU13660 (kinD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bsu01001]
    BSU13660 (kinD)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bsu02022]
    BSU13660 (kinD)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     BSU13660 (kinD)
Protein kinases [BR:bsu01001]
 Histidine kinases
  Spo family [OT]
   BSU13660 (kinD)
Two-component system [BR:bsu02022]
 Spo family
  KinABCDE-Spo0FA [MD:M00485]
   BSU13660 (kinD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dCache_1 HATPase_c HisKA FAM184 PspB HATPase_c_3 Baculo_11_kDa
Motif
Other DBs
NCBI-GeneID: 939300
NCBI-ProteinID: NP_389249
Pasteur: BG13309
BSORF: BG13309
UniProt: O31671
Structure
PDB: 

Position
complement(1431486..1433006)
Genome map
AA seq 506 aa AA seqDB search
MLERCKLKILKGACGRVKLYIILVVIPAIVISFFVYEKEKDTIAAEHKQEASVLLNLHRN
KINYLIGETMARMTSLSIAIDRPVDIKKMQSILEKTFDSEPRFSGLYFLNAKGDVTASTT
ELKTKVNLADRSFFIKAKETKKTVISDSYSSRITGQPIFTICVPVLDSKRNVTDYLVAAI
QIDYLKNLINLLSPDVYIEVVNQDGKMIFASGQASHAEDQKPVSGYLDDISWNMKVYPNP
VTIEELSKSLVLPLSCIIVLLNILFILVLYYLLKRQTQLERSENEAQKLELIGTLAASTA
HEIRNPLTGISGFIQLLQKKYKGEEDQLYFSIIEQEIKRINQIVSEFLVLGKPTAEKWEL
NSLQDIIGEIMPIIYSEGNLYNVEVELQYLTEQPLLVKCTKDHIKQVILNVAKNGLESMP
EGGKLTISLGALDKKAIIKVVDNGEGISQEMLDHIFLPFVTSKEKGTGLGLVVCKRIVLM
YGGSIHIESEVRRGTEVTITLPVSAS
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgttggagcgatgcaaattgaaaatactaaaaggcgcctgcgggagagtcaaactttat
atcatactggtcgtgattccggcaatcgtcatcagctttttcgtatatgaaaaagaaaaa
gatacaatagctgcagaacataaacaagaagcaagtgtcctgctaaaccttcaccgcaac
aaaatcaattatttaatcggagaaacaatggcgagaatgacctccttgtccatcgccatc
gacagaccggttgatataaagaaaatgcaatcaattttggaaaagacctttgattcagag
ccgagattttccggtctctattttctcaatgccaaaggagacgtcaccgcaagcacaacc
gaattaaaaacgaaagtaaacctggccgacagatctttttttataaaagcaaaggaaact
aaaaagacagtcatttcagatagttattcgagcagaattactggtcagccaattttcaca
atttgtgtgcctgttttggactcaaaacgtaatgtgacagattatcttgtcgcagctatt
caaattgattatttgaaaaatctcattaacttactaagccctgatgtttatattgaagtt
gtgaaccaagacgggaaaatgatttttgcgagcggacaagcctctcatgcagaggatcag
aaacctgtcagcggatatctggatgatatcagctggaatatgaaagtctatccgaacccg
gtcacaatagaagaactgtcgaaaagccttgtgcttccgctttcatgtattattgttctg
ctgaatatcctttttattctcgtgctgtattatttgctgaagcggcagacccagctggag
cgctcagaaaacgaggcgcaaaaattagagctgatcgggacgcttgctgccagcacagcc
catgaaatccgtaaccccctcaccgggataagcggctttattcagctgttgcaaaagaaa
tataaaggtgaggaagatcagctttacttctccattatcgaacaggagataaagcgcatc
aatcaaatagtgagtgagtttctcgttctcggcaagccgacagctgaaaaatgggagctg
aactcacttcaggacattatcggagaaattatgccgatcatttattctgagggcaatcta
tacaatgttgaagtcgaattacagtatctaaccgagcagcccttactcgtaaaatgtaca
aaagatcatattaaacaagtgattttaaatgtagcaaaaaatggcctcgagtcaatgcct
gaaggaggcaaactgacgatctccctaggagctttagataaaaaagccataatcaaagtt
gtggataacggtgaagggatttctcaggaaatgctggatcacatcttccttccctttgtt
acttctaaagaaaaaggaaccggtctcggccttgttgtttgtaaacggatcgtgctgatg
tacggaggctctattcatattgaaagtgaagtgcgaagaggcacagaggtgacgatcacc
ctccccgtatccgcatcatag

DBGET integrated database retrieval system