KEGG   Bacillus subtilis subsp. subtilis 168: BSU13670Help
Entry
BSU13670          CDS       T00010                                 

Gene name
mhqR
Definition
(RefSeq) MarR family transcriptional regulator
  KO
K15973  MarR family transcriptional regulator, 2-MHQ and catechol-resistance regulon repressor
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU13670 (mhqR)
Transcription factors [BR:bsu03000]
 Prokaryotic Type
  Helix-turn-helix
   MarR family
    BSU13670 (mhqR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MarR MarR_2 HTH_27 HTH_24 HTH_34
Motif
Other DBs
NCBI-GeneID: 939303
NCBI-ProteinID: NP_389250
Pasteur: BG13310
BSORF: BG13310
UniProt: O31672
Position
1433199..1433636
Genome map
AA seq 145 aa AA seqDB search
MTEKSLKLFIVLSRAYRSINDHMNKHIHKHGLNPTEFAVLELLYHKGDQPLQQIGDKILL
ASGSITYVVDKLEQKELLIRKASPTDRRVTFAQITEKGIGLLNDIFPDHAAEIDEMISVL
SEEEVEMCTEMLKRVGLNAKQFHNK
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaaaatcactgaagttatttatcgtgctgtcgcgcgcgtatcggtctattaac
gatcatatgaataagcatattcataagcatgggctgaatccgactgaatttgctgtgcta
gagcttttgtaccataaaggcgatcagccgctgcagcagataggagataaaattctcttg
gctagcgggagcatcacatacgttgtagataagctggagcaaaaagaacttctcattcgg
aaagcgtctcctacagacagacgagtgacatttgcgcaaattactgaaaaaggcatcggt
cttttgaacgatattttccctgatcacgctgctgaaattgatgaaatgatcagcgtatta
agcgaagaagaggtagagatgtgcaccgaaatgttaaaaagagtaggattaaacgcaaaa
cagtttcataataagtaa

DBGET integrated database retrieval system