KEGG   Bacillus subtilis subsp. subtilis 168: BSU13680Help
Entry
BSU13680          CDS       T00010                                 

Gene name
motB
Definition
(RefSeq) motility protein B
  KO
K02557  chemotaxis protein MotB
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02030  Bacterial chemotaxis
bsu02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    BSU13680 (motB)
   02040 Flagellar assembly
    BSU13680 (motB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU13680 (motB)
   02035 Bacterial motility proteins [BR:bsu02035]
    BSU13680 (motB)
Transporters [BR:bsu02000]
 Other Transporters
  Pores ion channels [TC:1]
   BSU13680 (motB)
Bacterial motility proteins [BR:bsu02035]
 Flagellar system
  Flagellar assembly proteins
   Motor/switch
    BSU13680 (motB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MotB_plug OmpA SPT16 FlaG Pro_CA LCD1
Motif
Other DBs
NCBI-GeneID: 939304
NCBI-ProteinID: NP_389251
Pasteur: BG10689
BSORF: BG10689
UniProt: P28612
Position
complement(1433676..1434461)
Genome map
AA seq 261 aa AA seqDB search
MARKKKKKHEDEHVDESWLVPYADILTLLLALFIVLYASSSIDAAKFQMLSKSFNEVFTG
GTGVLDYSSVTPPENESDGIDEVKKEKEEKEKNKKEKEKAADQEELENVKSQVEKFIKDK
KLEHQLETKMTSEGLLITIKDSIFFDSGKATIRKEDVPLAKEISNLLVINPPRNIIISGH
TDNMPIKNSEFQSNWHLSVMRAVNFMGLLIENPKLDAKVFSAKGYGEYKPVASNKTAEGR
SKNRRVEVLILPRGAAETNEK
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggcgagaaaaaagaagaagaagcatgaggacgagcacgttgatgaatcatggctcgtt
ccttacgccgacatccttactcttctcctggcattgtttattgtgctgtacgcgagcagc
tcgattgacgcagctaagtttcaaatgctctcaaaatcatttaatgaagtttttacaggc
ggaaccggtgtactggactactccagtgtcactcctcctgaaaacgagtcagacggcatc
gatgaagtgaaaaaggaaaaagaagagaaagagaaaaacaagaaagaaaaagaaaaagca
gctgatcaagaagaacttgaaaatgtgaagagccaggtggaaaagttcatcaaagataaa
aagctggaacatcagctggagacgaagatgactagtgaaggccttctgattacgattaaa
gacagcatcttcttcgattctggaaaagcgaccatccgtaaggaagatgtgccgcttgca
aaagagatttcaaatcttcttgtgattaacccgccaagaaatatcattatcagcggacat
actgataatatgccaattaaaaattctgaattccaatcaaactggcatttaagcgtcatg
agagcggtaaactttatggggctcctgattgaaaaccccaagctcgatgcaaaagtgttc
agcgccaagggttatggcgagtataaaccggtggcttccaataaaactgcggaaggccga
agcaaaaaccggcgggttgaagttctcattttgccgagaggcgcagcggaaacaaatgaa
aaatag

DBGET integrated database retrieval system