KEGG   Bacillus subtilis subsp. subtilis 168: BSU13690Help
Entry
BSU13690          CDS       T00010                                 

Gene name
motA
Definition
(RefSeq) motility protein A
  KO
K02556  chemotaxis protein MotA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
bsu02030  Bacterial chemotaxis
bsu02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU13690 (motA)
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    BSU13690 (motA)
   02040 Flagellar assembly
    BSU13690 (motA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU13690 (motA)
   02035 Bacterial motility proteins [BR:bsu02035]
    BSU13690 (motA)
Transporters [BR:bsu02000]
 Other Transporters
  Pores ion channels [TC:1]
   BSU13690 (motA)
Bacterial motility proteins [BR:bsu02035]
 Flagellar system
  Flagellar assembly proteins
   Motor/switch
    BSU13690 (motA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MotA_ExbB PTS_EIIC YwiC 5TM-5TMR_LYT SNARE_assoc TssN RseC_MucC FUSC_2
Motif
Other DBs
NCBI-GeneID: 939302
NCBI-ProteinID: NP_389252
Pasteur: BG10688
BSORF: BG10688
UniProt: P28611
Position
complement(1434433..1435245)
Genome map
AA seq 270 aa AA seqDB search
MDKTSLIGIILAFVALSVGMVLKGVSFSALANPAAILIIIAGTISAVVIAFPTKEIKKVP
TLFRVLFKENKQLTIEELIPMFSEWAQLARREGLLALEASIEDVDDAFLKNGLSMAVDGQ
SAEFIRDIMTEEVEAMEDRHQAGAAIFTQAGTYAPTLGVLGAVIGLIAALSHMDNTDELG
HAISAAFVATLLGIFTGYVLWHPFANKLKRKSKQEVKLREVMIEGVLSVLEGQAPKVIEQ
KLLMYLPAKDRLKFAEQGEAQNGEKKEEEA
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggataaaacttcgttaatcggtattattcttgcttttgtggcattgagcgtcgggatg
gttctgaaaggcgtcagtttcagcgcccttgcaaaccccgctgccattttaattattatc
gccgggacaatctcagcagtcgttattgcgttcccaacaaaagaaattaaaaaagtgcct
acgctgtttcgagtgttatttaaggaaaataaacagctcacaatagaggaactcattcct
atgttctctgaatgggctcagcttgcacgccgcgaaggtctgcttgctttagaagcaagc
attgaggatgtagatgatgctttcttgaaaaacgggctcagcatggctgttgacgggcaa
agcgcggaatttataagagatattatgacagaggaagtcgaagcaatggaggacaggcac
caagcaggagccgctatttttacacaagcaggaacgtacgctccgacacttggagtactc
ggcgctgtaatcgggctgattgccgctctctctcatatggataacacagatgagcttgga
cacgccatcagtgctgcctttgttgccacacttctcggtatctttacagggtatgtgtta
tggcatcctttcgcaaataaattaaaacgaaaatcaaaacaggaagtaaaactgcgtgag
gtcatgattgaaggtgttttatccgttttagaaggacaagcaccgaaagtcatcgaacaa
aagcttttaatgtatcttcctgcgaaggaccgcttgaaatttgcagaacaaggagaggcg
caaaatggcgagaaaaaagaagaagaagcatga

DBGET integrated database retrieval system